Entry information : SiPrx155 (Si036566m)
Entry ID 9498
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx155 (Si036566m)
Name (synonym) SiPrx155 (Si036566m)
Class Class III peroxidase    [Orthogroup: Prx092]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx155
start..stop
S start..stop
SbPrx15 559 0 2..320 3..332
ZmPrx145 547 0 1..320 1..336
ZmPrx144 537 0 18..320 35..337
OsPrx47 531 0 1..320 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45527964..45528021 58 N° 2 45527791..45527933 143 N° 3 45526953..45527711 759  
complement(join(45526953..45527711,45527791..45527933,45527964..45528021))


exon

Literature and cross-references SiPrx155 (Si036566m)
DNA ref. Phytozome 12:   scaffold_9 (45528021..45526953)
Protein sequence: SiPrx155 (Si036566m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (303)
PWM (Da):   %s   33376.97 (31750.1) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.45 (7.18) Peptide Signal:   %s   cut: 22 range:18-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASKVAAVLSCALLVVAATGGLKVGYYHEKCPHAEAIVKHVVGAAVRKNPGVGAGLIRMLFHDCFVGCDASVLLDPTPANPQPEKLSPPNNPSLRGFEVIDAAKAALERACPGVVSCADIVAFAARDASAFLGGRGVSFDMPAGRLDGRASVASRALDFLPPPVFTLPELVASFAAKGLGVEDMVVLSGAHTVGRSHCSSFVPDRLAAPSDINPSFAASLRGQCPASPSAGNDPTVVQDAVTPDALDNQYYKNVLAHRVLFTSDAALLTSPETAKMVSDNANIPGWWEDRFKKAMVKMASVEVKTGNHGEVRRNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGGTGGCCGCTGTGCTCTCGTGTGCGCTGCTGGTCGTGGCAGCGACTGGCTACTACACTCCTCCCAGCCCTGCCACCTGCGGGCTCAAGGTCGGGTACTACCACGAAAAG
TGCCCGCACGCCGAGGCCATCGTCAAGCACGTCGTCGGCGCCGCCGTCCGCAAGAACCCCGGCGTCGGCGCAGGACTCATCCGCATGCTCTTCCACGACTGCTTCGTCGAG
GTACATTTA
CACTCTCTGTTCATACATGCTGATGCACGTGGCTTGTTCTGAGTACTAACACCGTGGCACGCGTTGGCAGGGATGCGACGCCTCCGTGCTCCTGGACCCGACGCCGGCGAACCCGCAGCC
GGAGAAGCTGAGCCCGCCCAACAACCCCAGCCTGCGCGGCTTCGAGGTCATCGACGCCGCCAAGGCCGCGCTGGAGCGGGCCTGCCCGGGCGTCGTCTCCTGCGCGGACATCGTCGCCTT
CGCCGCCCGCGACGCGTCCGCCTTCCTCGGCGGCCGCGGGGTCAGCTTCGACATGCCCGCCGGCCGCCTCGACGGCCGCGCCTCCGTCGCCTCCCGCGCCCTCGACTTCCTCCCGCCGCC
CGTCTTCACGCTCCCCGAGCTCGTCGCCAGCTTCGCCGCCAAGGGGCTCGGCGTCGAGGACATGGTCGTGCTCTCCGGCGCCCACACCGTTGGCCGCTCCCACTGCTCCTCCTTCGTCCC
CGACCGCCTCGCCGCCCCCTCTGACATCAACCCGTCCTTCGCCGCGTCCCTCAGGGGCCAGTGCCCGGCGAGCCCGAGCGCCGGCAACGACCCCACCGTGGTGCAGGACGCCGTGACGCC
CGACGCCCTCGACAACCAGTACTACAAGAACGTGCTGGCGCACCGGGTGCTCTTCACCTCCGACGCGGCGCTCCTGACGTCGCCGGAGACGGCGAAGATGGTGTCGGACAACGCCAACAT
CCCCGGGTGGTGGGAGGACAGGTTCAAGAAGGCCATGGTGAAGATGGCCAGCGTCGAGGTGAAGACCGGTAACCACGGTGAGGTCAGGAGGAACTGCCGGGTGGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGCAAGGTGGCCGCTGTGCTCTCGTGTGCGCTGCTGGTCGTGGCAGCGACTGGCGGGCTCAAGGTCGGGTACTACCACGAAAAGTGCCCGCACGCCGAGGCCATCGTCAAGCAC
GTCGTCGGCGCCGCCGTCCGCAAGAACCCCGGCGTCGGCGCAGGACTCATCCGCATGCTCTTCCACGACTGCTTCGTCGAG
GGATGCGACGCCTCCGTGCTCCTGGACCCGACGCCGGCG
AACCCGCAGCCGGAGAAGCTGAGCCCGCCCAACAACCCCAGCCTGCGCGGCTTCGAGGTCATCGACGCCGCCAAGGCCGCGCTGGAGCGGGCCTGCCCGGGCGTCGTCTCCTGCGCGGAC
ATCGTCGCCTTCGCCGCCCGCGACGCGTCCGCCTTCCTCGGCGGCCGCGGGGTCAGCTTCGACATGCCCGCCGGCCGCCTCGACGGCCGCGCCTCCGTCGCCTCCCGCGCCCTCGACTTC
CTCCCGCCGCCCGTCTTCACGCTCCCCGAGCTCGTCGCCAGCTTCGCCGCCAAGGGGCTCGGCGTCGAGGACATGGTCGTGCTCTCCGGCGCCCACACCGTTGGCCGCTCCCACTGCTCC
TCCTTCGTCCCCGACCGCCTCGCCGCCCCCTCTGACATCAACCCGTCCTTCGCCGCGTCCCTCAGGGGCCAGTGCCCGGCGAGCCCGAGCGCCGGCAACGACCCCACCGTGGTGCAGGAC
GCCGTGACGCCCGACGCCCTCGACAACCAGTACTACAAGAACGTGCTGGCGCACCGGGTGCTCTTCACCTCCGACGCGGCGCTCCTGACGTCGCCGGAGACGGCGAAGATGGTGTCGGAC
AACGCCAACATCCCCGGGTGGTGGGAGGACAGGTTCAAGAAGGCCATGGTGAAGATGGCCAGCGTCGAGGTGAAGACCGGTAACCACGGTGAGGTCAGGAGGAACTGCCGGGTGGTCAAC

Retrieve as FASTA