Entry information : AtPrx14 (At2g18140 / PER14 / AtperoxP14)
Entry ID 95
Creation 2006-04-10 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx14 (At2g18140 / PER14 / AtperoxP14)
Name (synonym) AtPrx14 (At2g18140 / PER14 / AtperoxP14)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type Etiolated hypocotyls
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx14
start..stop
S start..stop
AtPrx15 612 0 1..337 1..338
AhalPrx05 610 0 1..337 1..339
BstrPrx49 606 0 1..337 1..337
AlyPrx15 605 0 1..337 1..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7888639..7888878 240 N° 2 7888353..7888544 192 N° 3 7888109..7888274 166 N° 4 7887584..7887999 416
complement(join(7887584..7887999,7888109..7888274,7888353..7888544,7888639..7888 878))


exon

Literature and cross-references AtPrx14 (At2g18140 / PER14 / AtperoxP14)
Protein ref. UniProtKB:   Q9SI17
DNA ref. Phytozome 12:   Chr2 (7888878..7887584)
mRNA ref. GenBank:   NM_127371
Cluster/Prediction ref. Phytozome Gene 12:   19642380
Omic ref. AtProteome:   At2g18140 ATTED-II:   At2g18140 e-FP Browser:   At2g18140 ePlant:   At2g18140 TAIR:   At2g18140
Protein sequence: AtPrx14 (At2g18140 / PER14 / AtperoxP14)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (321)
PWM (Da):   %s   37093.38 (35343.4)  
PI (pH):   %s   6.73 (6.29) Peptide Signal:   %s   cut: 17 range:17-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARIGSFLILLSLTYALTLCICDNASNFGGNKRNLFPDFYRSSCPRAEEIVRSVVAKAFERETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSWTVPLGRRDSATASRAKPNKDLPEPDNLFDTIFLRFSNEGLNLTDLVALSGSHTIGFSRCTSFRQRLYNQSGSGSPDTTLEKSYAAILRQRCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDQVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGKISPLTGSSGEIRKKCRKINNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and one cDNA. No EST. Identified by proteomic (Feiz, 2004)
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAAGATGTA TATCCAACTC AACAGACGCA TCTTCTCTTG TCTAAATCGG CCCTAAACTT CTGAAGAAAC CAAATTTAGA TTAGAAATTT GTCTACGAAT GAATTATCAA ATTATAGAAA  AGAACATACG AATGATTTCA ATCATCTACT ACAATTTTAG TATTAATTAA TCATAAAATA ATCACTAAAA TTACTTACTT TAGATATATG TCGCTGAGTG CCTTAAAATT GAGAAGAAAC  CAACAAAGAA AATAATTTAT AAAATTTAGT TAACGAATGA AAAAAGTAGG TCAATGTACT CAATGATGCC TCTTCTTTCC GTCGGTTATT ATTTTTGTCT TAGGACTGAG ACATATTTTT  TATGAGCTTT TCTGTTTAAT TGTTTTGGGC TGAAATATTA TTTTCGTTTT AATTGAGTTG GGTTGGACAT TAGGATAGGG CAATTCATTT TCTATTCTAA TGGCCCAAAA TATATAATCA  GTAAATGAAT TCAATGTGTA ATTTTGTTTT TCCTGAAAAA GAATGTCGGA CACGTGCCCA ACCCCCTCTA GACGTGGGTC CGCCCCTACT TGCAACTTAA CAACTTTTAA TGCTCATAAT  GTAATCAGTA AACATTGGTA AATTTAAACA GGAAAAATAT ACTAAAAAGA ATCCATATAT TTTTTATTGG ACGTTTAGTA CGCCAAATAT TTTAGTTGGA AAAAATATCC CATTTAAAAT  ATATATAATT AAAAAAATTC ATCTTTGAAT TATGGATAGA TTTGAGCCTA CGACTTAATA GCCATTAACA GGCATTACAA AATCACTGAA CGATGTTAAA TGTTTACTTC ATGTGTTGAT  ATATATATAT ATATATATAT ATATATAATC TTTATTCAAA ATTTACAAAT GTATTAGCGT TGTCTGGTGG TAATAAATGG ATTATTTAAA CCTTTTAATC ACCATCTATT TGTTACAAAG  TTTATTTTAA TCTTTTTAAT CACTACTACT TCTAACTTTT GGTTCTATTT TTGCTCTTTC AAACAAAAAA ATTAGTTTTA ACCGTAAAAA GTTAAAAACA TATATCTTTT TCCGACCAAA  CAATTTTTTA TTTTTTTTTG AATATTTGAA GGTTCTGGGA CAAAGCCCGT AATCCTACCA GACCTGAAAT CATAACATAT AATATTAGTT TCGTTCCAAA CGTCACTCGA ACCAACGATA  TCTAAACTTT GCATCGAATA TTAATTGAGC TAATAACACT TGGTCAAACA ACTTTATAAA AACCATTAAA CCAGCAATGT AACCGAAATG ACGGTAAAAT AGTCAAACAA CTCGTGCAAC  TTTGCGACAT TTGGATACCA AACCCCAAGA TTTAGTCCTT TTGAATTCAA GCCATTTTTT CAATAACAAT TCTTCAAAAT ACCACACTTT TAAATTTTGT TGTCAGGAAT ACTACTATTA  ATTTAATGTT CCAAAAATAC TATCAAAATA TTTTGTTTTT CAAAAATATC ACAACATCAA AAATTGATGT TCAAAGATTC AAAATATTGT TTTTAGGTTT GGGTTACCTA TTTTAGATTT  AGAGTATTTT TTTTAAGGGT TAAAATTTTG TGTTTATAGT TTAAGGGCCT TAGTTTTGAA TACTGAAAGT TTAATTTAGT TTTGTGGTAT CTTTGGAAAA CTAAAATGTA ATTGATATTT  TTATAATTAT TAAACTCTCT AAATATTAAA CTAATAGTGG TAATTTTAAA AACCAAAATT TAAATCCACG ATCTCTCTGT ATTTTTAAAA ATTATTGTCA TTTTTAATTT ATATCTTCTT  AATTGATTAA TTCCAATCAA GGTACCAAGT CTATTGCCTT TGTTTGTTCC TCTTCATGAC GCCAAACTCT CTGTATATAA ATTGATTTAT ATCTACTTAA TTGATTAATT CCAATCAAGG 
TACCAAGTCG ATTCTTCTTC TCTTATCATC ACAAAGTCAT CTCCTTTCTT ATTTCTTGAT CTAGCTAGCG ACAATTGAAA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAACGTAATA TTGAATGGGC GAAATAGAAA TGAGACTTAT TTTGGTCTTT TGGAAGAATG ATGATAACTT ATGTTTGTGG TTTTTTTTTC TTGTTTCTTT AAGTTAAGAA TTTGAAGTTG  TGAGTTCAAA AATGATTAAA ACTCTATATA CTTAAAAGGT TATTGCTATA ATTACGTTTG TTAAACACCT AATAAAAATT CTATAGATCA TTAATTAGAC TAGCGTAAAA TGGTCATGAA  AACTGAATAG AAGAAATATA AGTACTAGCC TAAAAATATA AGAAATTAAA CTAGGGCAAA AATTTATGTT TGATATTTAT TTCTTATTTT GTATGAGTCT GTAATTCCTT ATGTCAAGAA  TTTGAAATTG TGAGTTCAAA ATGATTAAAA CTCTATATAC TTAAAAGTTT ATTTCTATGA TTACGCTTGT TAAAGGTCCA ATGAAAACTC TATAGGCCAT TAATTAGACT AGCGCAAATG  GTCATGAAAT CTGAATAGAA GAAATATAAG GACTAGCGCA AAAATATAAG AAATTAAAGT AGCGCAAAAA TTTATGGTTG TGTTTTTTTT TTCTTATTTT GTATGAATCT ATATTTCTTT  ATGTCAATAA TTTGAATTTT TGAATTCAAA AATGATTAAA ACTCTATATA CTTAAAAGGT TATTTCTTTA ATTACGTTTG TTAAAAATCC AATGAAAACT CTATATGCCA TTAATTAGAC  TAGCGGAAAA TAGTCATGAA ATCTGAATAG AATAAATATA AAGACTAGCG CAAAAATATA AGAAATTAGA CTAGCACACA CATTTTTATG TTTTTTTTTT TTTTTTTTCA TATTTTGTAT  GAATCTGTAT TTCCTTATGT CAAGAATTTG AATTTGCAAG TTCAAAAATG ATTAAAACTC TAAATACTTA AAAAGTTACT TCTATATTTA CGTTTGTTAA ATGCCCAATG AAAACTCTAT 
AGGCCATTAA TTAGACTAGC GCAAAATGGT CATAAAACAG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCGGGAGCTTTCTCATTCTTCTGTCTCTCACTTACGCTCTTACTCTCTGCATCTGTGACAACGCGAGTAACTTTGGCGGCAACAAAAGGAACCTCTTCCCAGATTTCTAC
AGGAGCTCGTGCCCTAGAGCGGAGGAGATCGTGAGGTCCGTTGTAGCCAAGGCATTTGAAAGGGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTCCACGATTGTTTCGTTCAG
GTACTAGAGAGTCATTTTTAGAACTTGCTCAACAAGCTAATTACTAATGCTGAGAATCATCATTAATCTTATCTATTTAAATGAAAATGTGTAGGGTTGTGATGGATCGTTGCTTCTAGA
CACCAGTGGGAGTATAGTTACTGAGAAGAACTCTAACCCTAACAGCAGATCGGCTCGCGGGTTTGAAGTTGTTGACGAGATCAAGGCAGCATTAGAGAATGAATGCCCTAACACTGTCTC
TTGTGCTGACGCCTTAACTCTAGCTGCTAGAGACTCCTCTGTTCTT
GTAAGTCGCTTTCTTTCTCTTGCTCTCTCTTTTACTTCTTTGAGTTGTCAAGATTCAATTTCGTTTGGTTTTGT
GTAGACAGGTGGGCCAAGCTGGACGGTTCCTTTGGGAAGAAGAGATTCGGCAACTGCAAGCCGGGCTAAACCAAACAAAGACCTTCCTGAACCCGACAACTTGTTCGACACAATTTTCTT
GAGATTTAGCAATGAAGGTCTCAATCTGACTGACCTCGTTGCTCTATCCG
GTAAGCTTACTTCACACACAAGGAAGATTTTGACTTTACTTGCTTTGGAAGCTAACGTTAAACCTTACAA
AATGGTCGTGTCATACGTTCTGACCGAAAAAAATTTCAGGGAGCCACACCATTGGATTCTCAAGATGCACTAGTTTCAGACAGAGACTTTACAATCAATCCGGAAGCGGAAGTCCCGACA
CAACCTTAGAGAAATCCTACGCTGCTATCTTGCGCCAAAGGTGCCCTAGATCGGGTGGGGACCAGAACCTTTCCGAGCTTGACATCAACAGTGCTGGAAGATTTGATAACAGCTACTTTA
AGAACTTGATTGAGAACATGGGACTGTTGAATTCCGACCAAGTCTTGTTCTCTAGCAACGAACAATCGAGAGAGCTCGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAAT
TCGCGGAATCGATGATCAAGATGGGGAAGATCTCTCCCTTGACAGGTTCGAGTGGTGAGATCAGAAAGAAATGCAGGAAAATTAATAACTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCGGGAGCTTTCTCATTCTTCTGTCTCTCACTTACGCTCTTACTCTCTGCATCTGTGACAACGCGAGTAACTTTGGCGGCAACAAAAGGAACCTCTTCCCAGATTTCTAC
AGGAGCTCGTGCCCTAGAGCGGAGGAGATCGTGAGGTCCGTTGTAGCCAAGGCATTTGAAAGGGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTCCACGATTGTTTCGTTCAG
GGTTGTGATGGATCGTTGCTTCTAGACACCAGTGGGAGTATAGTTACTGAGAAGAACTCTAACCCTAACAGCAGATCGGCTCGCGGGTTTGAAGTTGTTGACGAGATCAAGGCAGCATTA
GAGAATGAATGCCCTAACACTGTCTCTTGTGCTGACGCCTTAACTCTAGCTGCTAGAGACTCCTCTGTTCTT
ACAGGTGGGCCAAGCTGGACGGTTCCTTTGGGAAGAAGAGATTCGGCA
ACTGCAAGCCGGGCTAAACCAAACAAAGACCTTCCTGAACCCGACAACTTGTTCGACACAATTTTCTTGAGATTTAGCAATGAAGGTCTCAATCTGACTGACCTCGTTGCTCTATCCG
GG
AGCCACACCATTGGATTCTCAAGATGCACTAGTTTCAGACAGAGACTTTACAATCAATCCGGAAGCGGAAGTCCCGACACAACCTTAGAGAAATCCTACGCTGCTATCTTGCGCCAAAGG
TGCCCTAGATCGGGTGGGGACCAGAACCTTTCCGAGCTTGACATCAACAGTGCTGGAAGATTTGATAACAGCTACTTTAAGAACTTGATTGAGAACATGGGACTGTTGAATTCCGACCAA
GTCTTGTTCTCTAGCAACGAACAATCGAGAGAGCTCGTGAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAATTCGCGGAATCGATGATCAAGATGGGGAAGATCTCTCCCTTG
ACAGGTTCGAGTGGTGAGATCAGAAAGAAATGCAGGAAAATTAATAACTCCTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAA TCGGGAGCTT TCTCATTCTT CTGTCTCTCA CTTACGCTCT TACTCTCTGC ATCTGTGACA ACGCGAGTAA CTTTGGCGGC AACAAAAGGA ACCTCTTCCC AGATTTCTAC  AGGAGCTCGT GCCCTAGAGC GGAGGAGATC GTGAGGTCCG TTGTAGCCAA GGCATTTGAA AGGGAGACTC GTATGGCTGC TTCTCTCATG AGGCTCCATT TCCACGATTG TTTCGTTCAG  GGTTGTGATG GATCGTTGCT TCTAGACACC AGTGGGAGTA TAGTTACTGA GAAGAACTCT AACCCTAACA GCAGATCGGC TCGCGGGTTT GAAGTTGTTG ACGAGATCAA GGCAGCATTA  GAGAATGAAT GCCCTAACAC TGTCTCTTGT GCTGACGCCT TAACTCTAGC TGCTAGAGAC TCCTCTGTTC TTACAGGTGG GCCAAGCTGG ACGGTTCCTT TGGGAAGAAG AGATTCGGCA  ACTGCAAGCC GGGCTAAACC AAACAAAGAC CTTCCTGAAC CCGACAACTT GTTCGACACA ATTTTCTTGA GATTTAGCAA TGAAGGTCTC AATCTGACTG ACCTCGTTGC TCTATCCGGG  AGCCACACCA TTGGATTCTC AAGATGCACT AGTTTCAGAC AGAGACTTTA CAATCAATCC GGAAGCGGAA GTCCCGACAC AACCTTAGAG AAATCCTACG CTGCTATCTT GCGCCAAAGG  TGCCCTAGAT CGGGTGGGGA CCAGAACCTT TCCGAGCTTG ACATCAACAG TGCTGGAAGA TTTGATAACA GCTACTTTAA GAACTTGATT GAGAACATGG GACTGTTGAA TTCCGACCAA  GTCTTGTTCT CTAGCAACGA ACAATCGAGA GAGCTCGTGA AGAAGTATGC AGAGGATCAA GAAGAGTTCT TCGAGCAATT CGCGGAATCG ATGATCAAGA TGGGGAAGAT CTCTCCCTTG 
ACAGGTTCGA GTGGTGAGAT CAGAAAGAAA TGCAGGAAAA TTAATAACTC CTGA 

Retrieve as FASTA