Entry information : SiPrx17 (Si002156m)
Entry ID 9512
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx17 (Si002156m)
Name (synonym) SiPrx17 (Si002156m)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx17
start..stop
S start..stop
SbPrx54 662 0 1..334 1..334
SofPrx04 635 0 1..334 1..334
ZmPrx18 634 0 21..334 20..333
BdiPrx56 628 0 1..334 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4671902..4672129 228 N° 2 4671063..4671254 192 N° 3 4670769..4670934 166 N° 4 4670248..4670663 416
complement(join(4670248..4670663,4670769..4670934,4671063..4671254,4671902..4672 129))


exon

Literature and cross-references SiPrx17 (Si002156m)
DNA ref. Phytozome 12:   scaffold_5 (4672129..4670248)
Protein sequence: SiPrx17 (Si002156m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   35866.08  
PI (pH):   %s   8.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MANSMGCLVLLCLVSPLLFANAVRSHPWGGLFPQFYDHSCPKAKEIVQSIVAQAVAKETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNRNSLRGFEVVDQIKAALEAACPGTVSCADILAIAARDSTVLVGGPYWDVPLGRRDSLGASIQGSNNDIPAPNNTLPTIITKFKLQGLNVVDVVALSGGHTIGMSRCTSFRQRLYNQTGNGMADSTLDVSYAAQLRQGCPRSGGDNNLFPLDFVTPAKFDNFYYKNILAGKGLLSSDEVLLTKSAETAALVKAYAADVNLFFQHFAQSMVNMGNISPLTGSQGEIRKNCRRLNNDH*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAACTCCATGGGTTGCCTCGTCTTGCTCTGCCTTGTTTCTCCCCTCCTCTTTGCCAATGCCGTCCGCAGCCACCCATGGGGCGGCTTGTTCCCACAGTTCTACGACCATTCATGC
CCCAAGGCGAAGGAGATCGTACAGTCCATTGTGGCACAGGCTGTGGCCAAGGAGACCAGGATGGCAGCATCCTTGGTCAGACTGCATTTCCATGACTGCTTTGTCAAA
GTAAACTCTGCT
TCCTCTCTTCTATTGTATTCTTTACATGACACAGCTATGATGCTTGCCAAACATAGTTCCTGCAGTGCACTAAAGCAAATTAGCGATAAAAGTTTAGTACTTCAAGTTTTGAGCTATATG
CTGGGTACAGTATAATAAGACTAACAAACGTGAAAAGCAAAGATTAACGTATGGATTAATTTACTAACTTTGGCTGTTATAACATAACTTAAAAATGGGCAAAGTAAAACTTCAACTCTG
TCCTGTATATGTGCCTAGGTACTGGAAAAGGAAGCATGGAAGAATCTATAGTATTTAGGCTAACTTATTTACTACTGATAAGAAAGACTACCTACATCGCCCATGCTAGCACTACTTTAT
GCCTTGGTGACATGATCGAGCCAGTACTATGATTGATTAACTCTGTTTCCCTTTTTTGAGTGAGATGTTTATTTTTGTGAGCCAAATGAGAAGATGTTTACCTAACTCTAGTGCACAATG
ATTGAAGCTCTCTGTGCAATGTTTGTCACCTTTTATTCAATGCATGTGCCTGCTGAATCTACTACCGCTACTACTACGTAGTGTGTGCCTAATCTCTAAACTATTTCCATCTGGCTAATA
ATTATCAATCTTTTCGGATACTGTTCCACATGTAGGGCTGCGATGCATCCGTGCTGTTGGACAACAGCAGCAGCATAGTCAGTGAGAAAGGGTCTAACCCCAACAGGAACTCCCTCAGGG
GGTTTGAGGTGGTCGACCAGATCAAGGCCGCTCTCGAGGCTGCCTGCCCAGGCACTGTCTCCTGCGCCGACATCCTCGCCATCGCAGCCCGTGACTCCACTGTCCTG
GTACGACCACCAT
CAATGATTCTGTCCAACCACAAGTGGAAGACATGATATTTATATATCCATAGCTTTGGCCTTTGGCAAAGGAAGTGCTCCTGGCATGATGATTTTTTTTTAACTCTAAACTGTAGGTTGG
TGGCCCATACTGGGACGTGCCACTTGGCAGGAGGGACTCGCTCGGTGCAAGCATCCAGGGCTCCAACAATGATATCCCAGCCCCCAACAACACGCTCCCCACCATCATCACCAAGTTCAA
GCTCCAAGGCCTCAACGTTGTGGATGTCGTCGCCCTCTCTG
GTGACTTTTCATGCTATTTCATAATTTCTCCTGTACTTTGTTATTCACCGACTTAACGTAGACTCACACTAGACAACAT
GGATTTGACTCCACATATATGTATAGGTGGTCACACCATAGGTATGTCTCGGTGCACCAGCTTCCGGCAGAGGCTGTACAACCAAACGGGCAATGGCATGGCTGACAGCACACTGGATGT
ATCGTACGCGGCACAGCTGAGACAGGGGTGCCCCCGCTCTGGTGGTGACAACAACCTCTTCCCCTTGGACTTTGTCACCCCAGCCAAATTTGACAATTTTTATTACAAGAACATCCTGGC
CGGCAAGGGCCTCCTCAGCTCTGATGAGGTTCTGTTGACCAAGAGTGCCGAGACAGCAGCACTCGTGAAGGCATATGCTGCTGATGTCAATCTCTTCTTCCAGCACTTTGCACAGTCTAT
GGTGAACATGGGCAACATTTCACCACTAACTGGGTCACAGGGTGAGATCAGGAAGAATTGCAGGAGGCTCAACAACGACCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAACTCCATGGGTTGCCTCGTCTTGCTCTGCCTTGTTTCTCCCCTCCTCTTTGCCAATGCCGTCCGCAGCCACCCATGGGGCGGCTTGTTCCCACAGTTCTACGACCATTCATGC
CCCAAGGCGAAGGAGATCGTACAGTCCATTGTGGCACAGGCTGTGGCCAAGGAGACCAGGATGGCAGCATCCTTGGTCAGACTGCATTTCCATGACTGCTTTGTCAAA
GGCTGCGATGCA
TCCGTGCTGTTGGACAACAGCAGCAGCATAGTCAGTGAGAAAGGGTCTAACCCCAACAGGAACTCCCTCAGGGGGTTTGAGGTGGTCGACCAGATCAAGGCCGCTCTCGAGGCTGCCTGC
CCAGGCACTGTCTCCTGCGCCGACATCCTCGCCATCGCAGCCCGTGACTCCACTGTCCTG
GTTGGTGGCCCATACTGGGACGTGCCACTTGGCAGGAGGGACTCGCTCGGTGCAAGCATC
CAGGGCTCCAACAATGATATCCCAGCCCCCAACAACACGCTCCCCACCATCATCACCAAGTTCAAGCTCCAAGGCCTCAACGTTGTGGATGTCGTCGCCCTCTCTG
GTGGTCACACCATA
GGTATGTCTCGGTGCACCAGCTTCCGGCAGAGGCTGTACAACCAAACGGGCAATGGCATGGCTGACAGCACACTGGATGTATCGTACGCGGCACAGCTGAGACAGGGGTGCCCCCGCTCT
GGTGGTGACAACAACCTCTTCCCCTTGGACTTTGTCACCCCAGCCAAATTTGACAATTTTTATTACAAGAACATCCTGGCCGGCAAGGGCCTCCTCAGCTCTGATGAGGTTCTGTTGACC
AAGAGTGCCGAGACAGCAGCACTCGTGAAGGCATATGCTGCTGATGTCAATCTCTTCTTCCAGCACTTTGCACAGTCTATGGTGAACATGGGCAACATTTCACCACTAACTGGGTCACAG
GGTGAGATCAGGAAGAATTGCAGGAGGCTCAACAACGACCAC

Retrieve as FASTA