Entry information : SiPrx172 (Si040234m)
Entry ID 9515
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx172 (Si040234m)
Name (synonym) SiPrx172 (Si040234m)
Class Class III peroxidase    [Orthogroup: Prx123]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx172
start..stop
S start..stop
SiPrx170 561 0 1..322 1..322
OsPrx44 543 0 2..322 3..323
BdiPrx41 541 0 2..322 3..323
OsPrx42 509 0 21..322 22..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45582997..45583203 207 N° 2 45582136..45582894 759  
complement(join(45582136..45582894,45582997..45583203))


exon

Literature and cross-references SiPrx172 (Si040234m)
DNA ref. Phytozome 12:   scaffold_9 (45583203..45582136)
Protein sequence: SiPrx172 (Si040234m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (299)
PWM (Da):   %s   34383.28 (32007.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.59 (7.29) Peptide Signal:   %s   cut: 24 range:24-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASFRLAVAVTCALLLATACQGLDVGYYKKTCPRVEHIVRDEVKKFVYKNAGIGAGLMRMLCDDCFGEGCDGSVLLDPTPANPQPEKLSPPNFPSLRGFEVIDAAKDAVEKACPGVVSCADIVAFAARDAAYFLSGFNMKIDMPAGRLDGRVSSSSDALNNLPPPVFNVAQLVGSFAGKGLNAEDMVVLSGAHTIGRSHCSSFVPDRLAVPSDINAGFANFLRGQCPANPTPANDPTVNQDIVTPNGLDNQYYKNVLAHKVLFTSDATLLTTPATAKMVQDSANIPGWWEGKFKKAFVEMSKIEVKTGKQGEIRKQCRVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCGTTCAGGCTCGCCGTGGCGGTGACATGCGCCCTGTTGCTGGCGACGGCGTGTCAGGGCTTGGATGTGGGCTACTACAAGAAGACGTGCCCGCGCGTGGAGCACATCGTG
AGAGACGAGGTGAAGAAGTTCGTCTACAAGAACGCCGGCATCGGCGCCGGCCTCATGCGCATGCTCTGCGACGACTGCTTCGGTGAG
GTAACGCACTGTTGACCGTGCACACGAACACGA
TCGAGATGCTTCTTCGTGCAATGCTGCAAGGGATGCGACGACACTGACACGATGCACACTTATATATAGGGATGTGACGGCTCCGTCCTCCTGGACCCAACGCCGGCGAACCCGCAGCCG
GAGAAGCTGAGCCCGCCCAACTTCCCCAGTCTGCGCGGCTTCGAGGTGATCGACGCGGCCAAGGACGCCGTCGAGAAGGCCTGCCCCGGCGTCGTCTCCTGCGCGGACATCGTCGCCTTC
GCCGCCCGCGACGCCGCCTACTTCCTCAGCGGGTTCAACATGAAGATCGACATGCCCGCCGGCCGCCTCGACGGGCGCGTCTCCAGCTCCTCCGACGCCCTGAACAACCTGCCGCCGCCC
GTCTTCAACGTCGCCCAGCTCGTCGGCAGCTTCGCCGGCAAGGGCCTCAACGCCGAGGACATGGTCGTGCTCTCGGGAGCCCACACCATCGGACGCTCCCACTGCTCGTCCTTCGTCCCC
GACCGCCTCGCCGTCCCCTCCGACATCAACGCCGGGTTCGCCAACTTCCTCAGGGGGCAGTGCCCCGCCAACCCGACGCCGGCCAACGACCCCACCGTGAACCAGGACATCGTCACCCCC
AACGGACTCGACAACCAGTACTACAAGAACGTGCTGGCGCACAAGGTGCTCTTCACGTCCGACGCCACGCTGCTCACCACGCCGGCGACGGCCAAGATGGTGCAAGACAGCGCCAACATC
CCCGGGTGGTGGGAGGGCAAGTTCAAGAAGGCATTCGTCGAGATGTCCAAAATCGAGGTGAAGACCGGCAAGCAGGGCGAGATCAGGAAGCAATGCAGGGTCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTCGTTCAGGCTCGCCGTGGCGGTGACATGCGCCCTGTTGCTGGCGACGGCGTGTCAGGGCTTGGATGTGGGCTACTACAAGAAGACGTGCCCGCGCGTGGAGCACATCGTG
AGAGACGAGGTGAAGAAGTTCGTCTACAAGAACGCCGGCATCGGCGCCGGCCTCATGCGCATGCTCTGCGACGACTGCTTCGGTGAG
GGATGTGACGGCTCCGTCCTCCTGGACCCAACG
CCGGCGAACCCGCAGCCGGAGAAGCTGAGCCCGCCCAACTTCCCCAGTCTGCGCGGCTTCGAGGTGATCGACGCGGCCAAGGACGCCGTCGAGAAGGCCTGCCCCGGCGTCGTCTCCTGC
GCGGACATCGTCGCCTTCGCCGCCCGCGACGCCGCCTACTTCCTCAGCGGGTTCAACATGAAGATCGACATGCCCGCCGGCCGCCTCGACGGGCGCGTCTCCAGCTCCTCCGACGCCCTG
AACAACCTGCCGCCGCCCGTCTTCAACGTCGCCCAGCTCGTCGGCAGCTTCGCCGGCAAGGGCCTCAACGCCGAGGACATGGTCGTGCTCTCGGGAGCCCACACCATCGGACGCTCCCAC
TGCTCGTCCTTCGTCCCCGACCGCCTCGCCGTCCCCTCCGACATCAACGCCGGGTTCGCCAACTTCCTCAGGGGGCAGTGCCCCGCCAACCCGACGCCGGCCAACGACCCCACCGTGAAC
CAGGACATCGTCACCCCCAACGGACTCGACAACCAGTACTACAAGAACGTGCTGGCGCACAAGGTGCTCTTCACGTCCGACGCCACGCTGCTCACCACGCCGGCGACGGCCAAGATGGTG
CAAGACAGCGCCAACATCCCCGGGTGGTGGGAGGGCAAGTTCAAGAAGGCATTCGTCGAGATGTCCAAAATCGAGGTGAAGACCGGCAAGCAGGGCGAGATCAGGAAGCAATGCAGGGTC
GTCAAC

Retrieve as FASTA