Entry information : SiPrx23 (Si003834m)
Entry ID 9521
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-12 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx23 (Si003834m)
Name (synonym) SiPrx23 (Si003834m)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx23
start..stop
S start..stop
BdiPrx68 325 8e-113 10..199 8..197
TaPrx05-1A 308 2e-106 35..199 38..202
OsPrx1617 308 5e-106 26..199 28..201
HvPrx60 275 3e-95 11..181 7..175
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18475185..18475424 240 N° 2 18475529..18475717 189 N° 3 18475845..18476078 234  
join(18475185..18475424,18475529..18475717,18475845..18476078)


exon

Literature and cross-references SiPrx23 (Si003834m)
DNA ref. Phytozome 12:   scaffold_5 (18475185..18476078)
Protein sequence: SiPrx23 (Si003834m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221 (191)
PWM (Da):   %s   23373.99 (20517.4) Transmb domain:   %s   i13-35o
PI (pH):   %s   5.95 (5.29) Peptide Signal:   %s   cut: 31 range:31-221
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKGLLTGTGLMLALLLLVFSAVGVGTASAQAAGLKKGFYKKSCPQAEDIARKVVWGRVAGNGELAAKFLRMFFHDCFVRGCDASVLLDSPTNTVEKNAPPNLSLAGFDVIDEVKAELERACPGVVSCADIVALAARDSVSFQYKRNLWEVETGRRDGTVSSDQEALNDIPAPTSTFDVLLSNFSSKGLGLQDLVVLSGTCPFPVVCSLTRTLQYSTVYAI

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGGGATTGCTCACGGGCACGGGCTTGATGCTGGCCCTGCTGCTTCTGGTGTTCTCCGCCGTCGGCGTTGGCACGGCGTCGGCGCAGGCGGCGGGGCTGAAGAAGGGGTTCTAC
AAGAAGAGCTGCCCGCAGGCGGAGGACATCGCGCGGAAGGTGGTGTGGGGGCGCGTCGCCGGCAACGGCGAGCTCGCCGCCAAGTTCCTCCGCATGTTCTTCCACGACTGCTTCGTCAGG
GTATGTGCGTGGATGACATGATTGAGTGAGATGAGATGTTACTGTTATCTATACCTAGAATGGAGGTGCGTTAATGCATGCAAACCGTTGCCTTTGTACTACAGGGCTGCGACGCGTCGG
TGCTCCTGGACTCGCCGACCAACACGGTGGAGAAGAACGCGCCGCCCAACCTGTCGCTGGCCGGGTTCGACGTGATCGACGAGGTGAAGGCGGAGCTAGAGCGGGCGTGCCCCGGGGTCG
TCTCCTGCGCCGACATCGTCGCGCTCGCTGCCAGGGACTCCGTCTCGTTCCAG
GTGATTACTGCACCGCGTACCTTCTAATGCTCTTCTTCCTCCTCGCGACGTCGTCGAATTAATGGCT
TAGCACGATGATGTATACGGAAGCGATCAATAACGAACCGCGCGCGCGTGATGTGCGCAGTACAAGAGGAATCTGTGGGAGGTGGAGACGGGGCGTCGCGACGGCACGGTGTCGAGCGAC
CAGGAGGCGCTGAACGACATCCCGGCGCCGACCTCCACCTTCGACGTCCTCCTCTCCAACTTCTCCAGCAAAGGGCTCGGACTCCAGGACCTCGTCGTCCTCTCAGGTACATGTCCGTTC
CCAGTAGTATGTTCACTCACAAGGACTCTGCAGTATTCTACAGTGTATGCTATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGGGATTGCTCACGGGCACGGGCTTGATGCTGGCCCTGCTGCTTCTGGTGTTCTCCGCCGTCGGCGTTGGCACGGCGTCGGCGCAGGCGGCGGGGCTGAAGAAGGGGTTCTAC
AAGAAGAGCTGCCCGCAGGCGGAGGACATCGCGCGGAAGGTGGTGTGGGGGCGCGTCGCCGGCAACGGCGAGCTCGCCGCCAAGTTCCTCCGCATGTTCTTCCACGACTGCTTCGTCAGG
GGCTGCGACGCGTCGGTGCTCCTGGACTCGCCGACCAACACGGTGGAGAAGAACGCGCCGCCCAACCTGTCGCTGGCCGGGTTCGACGTGATCGACGAGGTGAAGGCGGAGCTAGAGCGG
GCGTGCCCCGGGGTCGTCTCCTGCGCCGACATCGTCGCGCTCGCTGCCAGGGACTCCGTCTCGTTCCAG
TACAAGAGGAATCTGTGGGAGGTGGAGACGGGGCGTCGCGACGGCACGGTG
TCGAGCGACCAGGAGGCGCTGAACGACATCCCGGCGCCGACCTCCACCTTCGACGTCCTCCTCTCCAACTTCTCCAGCAAAGGGCTCGGACTCCAGGACCTCGTCGTCCTCTCAGGTACA
TGTCCGTTCCCAGTAGTATGTTCACTCACAAGGACTCTGCAGTATTCTACAGTGTATGCTATC

Retrieve as FASTA