Entry information : SiPrx24 (Si003948m)
Entry ID 9522
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-12 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx24 (Si003948m)
Name (synonym) SiPrx24 (Si003948m)
Class Class III peroxidase     [Orthogroup: Prx145]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx24
start..stop
S start..stop
SbPrx56 521 0 6..311 7..334
ZmPrx121 511 0 3..311 2..333
OsPrx06 463 5e-166 18..311 14..336
BdiPrx58 429 2e-152 19..311 19..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2904858..2905103 246 N° 2 2905307..2905993 687  
join(2904858..2905103,2905307..2905993)


exon

Literature and cross-references SiPrx24 (Si003948m)
DNA ref. Phytozome 12:   scaffold_5 (2904858..2905993)
Protein sequence: SiPrx24 (Si003948m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (280)
PWM (Da):   %s   34112.71 (30906.9) Transmb domain:   %s   i9-31o
PI (pH):   %s   10.5 (10.41) Peptide Signal:   %s   cut: 32 range:32-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTKRDSTTGVPLLAVLLPVLLSWIAVSSVASSEVARLQVGYYNRTCPRAEDLIRNIVHAAIRRDPGNGPGLVRLYFHDCFVRANNPSLRGFGVIDRAKRVLERRCRRTVSCADIVAFAARDACRIMGGIGFAVPAGRRDGRVSNASEVLGNLPGPFANVTNLVGSFAAKNLTADDMVALSGAHSFGRSHCSAFSFRLYPRIAEDMNATYGARLRKRCPAATGRRDRVVDLDPRTELLLDNQYYRNVQTREVLFTSDVTLLSQNDTAALVDLYARNRTLWAARFAAAMVKMGHLDVLTGSQGEIRKFCNRVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (Short sequence after FHDCFV is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAGAGACAGCACCACCGGTGTTCCTCTGCTGGCTGTTCTTCTTCCCGTTCTGCTGTCGTGGATCGCCGTCTCCTCCGTCGCGTCATCGGAGGTGGCGCGCCTACAAGTCGGT
TACTACAACCGCACTTGTCCCCGGGCGGAGGACCTCATCCGCAACATCGTCCACGCCGCCATCCGGCGAGACCCCGGCAATGGCCCCGGCCTCGTGCGCCTCTACTTCCACGACTGCTTC
GTCAGG
GTTAGCTAGCTAGCTCTGTTCGCCTGCGTCATCATCAACAGGGTTTTTTTGATAGAGGATCATCAACAGGGTTGAAGCATGGATGCGAGTAGTGAAGCTAACCACTCCATTTTT
AACTGTATATGTTTCAGGGGTGCGACGCGTCCGTGCTTCTGGACACCGCCCCCGGCAGCAACGCGACCTCGGTGGAGAAGGCGTCGCAGGCCAACAACCCAAGCCTCCGGGGGTTCGGCG
TCATCGACCGCGCGAAGCGCGTGCTGGAGCGGCGGTGCCGGCGGACCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGCGACGCCTGCCGCATCATGGGCGGGATCGGCTTCGCCG
TGCCAGCGGGCCGCCGCGACGGCCGCGTCTCCAACGCCTCCGAGGTGCTCGGCAACCTCCCCGGGCCCTTCGCCAACGTCACCAACCTCGTCGGCTCCTTCGCCGCCAAGAACCTCACCG
CCGACGACATGGTCGCGCTCTCCGGCGCGCACTCCTTCGGCCGCTCCCACTGCTCCGCCTTCTCCTTCCGGCTCTACCCGCGGATCGCGGAGGATATGAATGCCACCTACGGCGCGCGCC
TCAGGAAGCGGTGCCCCGCGGCGACGGGCCGCCGGGACAGGGTGGTGGACCTGGACCCGAGGACGGAGCTCCTGCTGGACAACCAGTACTACAGGAACGTGCAGACGCGGGAGGTGCTCT
TCACGTCGGACGTGACGCTGCTCAGCCAGAACGACACGGCGGCGCTTGTCGACCTCTACGCGCGCAACCGGACGCTGTGGGCGGCGCGGTTCGCGGCCGCCATGGTCAAGATGGGCCACC
TCGACGTGCTCACCGGCAGCCAAGGGGAGATCAGGAAATTCTGCAACAGAGTAAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAAGAGAGACAGCACCACCGGTGTTCCTCTGCTGGCTGTTCTTCTTCCCGTTCTGCTGTCGTGGATCGCCGTCTCCTCCGTCGCGTCATCGGAGGTGGCGCGCCTACAAGTCGGT
TACTACAACCGCACTTGTCCCCGGGCGGAGGACCTCATCCGCAACATCGTCCACGCCGCCATCCGGCGAGACCCCGGCAATGGCCCCGGCCTCGTGCGCCTCTACTTCCACGACTGCTTC
GTCAGG
GCCAACAACCCAAGCCTCCGGGGGTTCGGCGTCATCGACCGCGCGAAGCGCGTGCTGGAGCGGCGGTGCCGGCGGACCGTCTCCTGCGCCGACATCGTCGCCTTCGCCGCGCGC
GACGCCTGCCGCATCATGGGCGGGATCGGCTTCGCCGTGCCAGCGGGCCGCCGCGACGGCCGCGTCTCCAACGCCTCCGAGGTGCTCGGCAACCTCCCCGGGCCCTTCGCCAACGTCACC
AACCTCGTCGGCTCCTTCGCCGCCAAGAACCTCACCGCCGACGACATGGTCGCGCTCTCCGGCGCGCACTCCTTCGGCCGCTCCCACTGCTCCGCCTTCTCCTTCCGGCTCTACCCGCGG
ATCGCGGAGGATATGAATGCCACCTACGGCGCGCGCCTCAGGAAGCGGTGCCCCGCGGCGACGGGCCGCCGGGACAGGGTGGTGGACCTGGACCCGAGGACGGAGCTCCTGCTGGACAAC
CAGTACTACAGGAACGTGCAGACGCGGGAGGTGCTCTTCACGTCGGACGTGACGCTGCTCAGCCAGAACGACACGGCGGCGCTTGTCGACCTCTACGCGCGCAACCGGACGCTGTGGGCG
GCGCGGTTCGCGGCCGCCATGGTCAAGATGGGCCACCTCGACGTGCTCACCGGCAGCCAAGGGGAGATCAGGAAATTCTGCAACAGAGTAAAC

Retrieve as FASTA