Entry information : SiPrx27 (Si006833m)
Entry ID 9525
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx27 (Si006833m)
Name (synonym) SiPrx27 (Si006833m)
Class Class III peroxidase    [Orthogroup: Prx114]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx27
start..stop
S start..stop
SbPrx143 578 0 26..325 40..336
OsPrx90 568 0 11..325 27..337
ZmPrx69 564 0 26..325 37..331
HvPrx71 541 0 22..325 46..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37001673..37001873 201 N° 2 37001387..37001578 192 N° 3 36999985..37000150 166 N° 4 36999029..36999444 416
complement(join(36999029..36999444,36999985..37000150,37001387..37001578,3700167 3..37001873))


exon

Literature and cross-references SiPrx27 (Si006833m)
DNA ref. Phytozome 12:   scaffold_4 (37001873..36999029)
Protein sequence: SiPrx27 (Si006833m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (306)
PWM (Da):   %s   34580.32 (32622.4)  
PI (pH):   %s   8.31 (8.38) Peptide Signal:   %s   cut: 20 range:20-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAVVVVMAATAWCAAAQAAQLSQSYYASTCPNVETLVRGAVTQKLQETFNAAPGTLRLFFHDCFVRGCDASVLLSGPDDEHSAGADTTLSPDALDLITRAKAAVDGDAQCANKVSCADILALAARDVVSQTGGPYYQVELGRLDGKVGTRAVVKHSLPGAGFDLDQLNTLFAANGLTQTDMIALSGGHTIGVTHCDKFVRRLYPFKGSRGGAGGAGPPMNLYFLRQMRQTCPLNYSPSAFAMLDAVTPRKFDNGYYQTLQQMKGLLASDQVLFADRRSRATVNYFAANQTAFFDAFVAAMAKLGRVGVKTGSDGEIRRVCTKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCGGTGGTCGTAGTGATGGCCGCGACGGCGTGGTGCGCGGCGGCGCAAGCGGCGCAGCTGAGCCAGAGCTACTACGCGTCGACGTGCCCCAACGTGGAGACCCTTGTCCGCGGC
GCCGTCACCCAGAAGCTGCAGGAGACCTTCAACGCCGCGCCGGGCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GTAACTTCAATCACCTGTCACGTCCGTCGATTCCTACGT
TCTGTACTTGTTGCGTCGGTCGAGATTGACGCACGGCGATCTTGATTGATTGCAGGGCTGCGACGCGTCGGTGCTGCTGTCGGGCCCCGACGACGAGCACAGCGCCGGCGCCGACACGAC
GCTGTCCCCGGACGCGCTGGACCTCATCACCCGCGCCAAGGCCGCCGTCGACGGCGACGCGCAGTGCGCCAACAAGGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGTCGT
CTCCCAG
GTACTCAGCGATCCCAATTCCCACTGCACACCCGGCACTCTCTACCCCAACCCCAACTCCCGTAGAAAGAAATTTCGTTGGCGCTGTCTCCCTTTCCGTCGCTTTCGGCGCCT
GAACGGGACGGGGAGGGAAACCGGCGAGCCAGCCGTTTGCGCAAACAAAGCTTGCTTGCTTTCCAGGCGGTTATGCCACTTTGGCCGGTGTGGGATTAGCGAAGGGAGCTCACGCTTAAA
CCCTACGCCATTAGCGCACCGCACACCCTCGCCACGCTAATTAATTTCTCCCCTGCTCTCGAGTGGTTCTCGGCTGCCGCGCGCCCGCCGGGCGACAGCCATGATGAGGAAGGGGCAGGC
TGACATGTACGGCGGCCACTGCGCCCGCGTGTGCACGCGCGTGCCCGGCGCCGACGGATTCCGCAGCCGCAGCGGCAGCGCCAGTCCGCACTGCTGACCCTTAGCTGTGCCGCAACAACC
ATCCGTGTCCAGTCCATCCCCCTGTCGTCGTCTTCCCCTGATTCTCCCAAGCAACCTCGAAGCTGATTAGGTCTGTGCAGACTGAATGCTTTGTTAGGAAGCCAGGATTAGCACAAAGCA
GGAGCTGCAAAGAGGAGGGGAGGAGTTCAAACAAAGAAAAATTGGATTCAGATTTGGCGCTAAGACATGGGATTGGGAGTGGTCCTGGTAGGCTGGTACCGCGCCCTGTCGGAATTCCGC
TGTCCCAGCTCATTCATTCACTCGCTCGGGGCAGGCAGGGAAGGCAGCCGGTCCAGAGCCGGCCGGGACGGGGCATGGCGCGACGGGGAGCGCGTTACTGCTCTGCTCGTGGTGCCGGCG
GGCCTTTCTTCAATTCCCTTCCCTGACGGAACCCCGGACACGGTTTGGCGCCGTAAATGAGGCTGCACGGGGTCGACAGATACGGCCACCCGATACCTAATCCGCCGGGCGATGCTGTGC
AGTTTCCCCGGCCTCCCTGGACGGACAGACCGGCCGGCCGGCCAGCCCGCCGGCGCTCGTAGAGTAGAGTAGAGATACGGGCTCGTCAGTTATGATTGAGCCGAGCAACTCTGCCGAAAT
TTCTGCCCATGTTCATATGCTATTCGGGAGCGAGTGTACTGCGTTGGAGTAGGTTGCAAGCTGCTTTGGATGTGAATTCCTTTTGTTTTTGTAGTAACTGAAGATTTGACTGCAAGACTA
CTGAGTACTACTGACGGTGAGGATTTGTTTGGTGGATGTGCAGACGGGCGGGCCGTACTATCAGGTGGAGCTGGGGCGGCTTGACGGCAAGGTGGGCACGCGCGCCGTGGTGAAGCACAG
CCTCCCCGGCGCCGGCTTCGACCTGGACCAGCTCAACACCCTCTTCGCCGCCAACGGCCTCACCCAGACCGACATGATCGCGCTCTCAG
GTACGCCGCCACCGCGCATTATTTATATATA
TGTATATACCTCTTCACGTCCGCATCACGAGTTCACGACATGCCATGCCATTGCCATCTTGTGGTTAGCGAGTCGCCTGTCACGAACGCGGCGGCGAGCAGGCCGGTTGGCAGCTGCGGT
CGGGATCGCTGTGCCTCATAACTCCGTTGGCTCCGTCTCGTCTGCGCCTCCGATCCCGGCGACTGGGCTACTGAGCATTTGTTGCTCGTAGAAGCGCATGTCCTTTCCAGCCTGGCGTTG
GGTATGCATGCCCAGCTTCTCACTGCGGCGTGCAGGCTTTTCCCTTGGCATGGTCCCGTTGGTTTGGTTCTTCCGTGTCCATGGAGTCAGTCAGTCCATTGCTGCTGCTCGCTACACGTT
CTGGGTGTCAGCCTGGCCGTAGTAAAAACTTTGAACTGTTCTGTGTCAGCGTTTGTACACAGCAGTGCAACCATCACGATTGGTGATCGAGCGATGACGCCGCCACAGTGTCACTGACGT
GCTGTGCTTGCGATGCGCGACTCATGCAGGTGGGCACACGATCGGCGTGACGCACTGCGACAAGTTCGTGCGGCGGCTGTACCCGTTCAAGGGCTCCCGAGGCGGCGCCGGCGGTGCGGG
GCCGCCGATGAACCTCTACTTCCTGCGGCAGATGCGGCAGACGTGCCCGCTCAACTACAGCCCGTCGGCGTTCGCGATGCTGGACGCCGTGACGCCGCGCAAGTTCGACAACGGCTACTA
CCAGACGCTGCAGCAGATGAAGGGCCTGCTCGCCTCCGACCAGGTCCTCTTCGCCGACCGCCGCTCCCGCGCCACCGTCAACTACTTCGCCGCAAACCAGACCGCCTTCTTCGACGCCTT
CGTCGCCGCCATGGCCAAGCTCGGCCGCGTCGGCGTCAAGACCGGATCCGATGGCGAGATCCGCCGGGTCTGCACCAAGGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCGGTGGTCGTAGTGATGGCCGCGACGGCGTGGTGCGCGGCGGCGCAAGCGGCGCAGCTGAGCCAGAGCTACTACGCGTCGACGTGCCCCAACGTGGAGACCCTTGTCCGCGGC
GCCGTCACCCAGAAGCTGCAGGAGACCTTCAACGCCGCGCCGGGCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCAGG
GGCTGCGACGCGTCGGTGCTGCTGTCGGGCCCCGACGAC
GAGCACAGCGCCGGCGCCGACACGACGCTGTCCCCGGACGCGCTGGACCTCATCACCCGCGCCAAGGCCGCCGTCGACGGCGACGCGCAGTGCGCCAACAAGGTCTCCTGCGCCGACATC
CTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
ACGGGCGGGCCGTACTATCAGGTGGAGCTGGGGCGGCTTGACGGCAAGGTGGGCACGCGCGCCGTGGTGAAGCACAGCCTCCCCGGC
GCCGGCTTCGACCTGGACCAGCTCAACACCCTCTTCGCCGCCAACGGCCTCACCCAGACCGACATGATCGCGCTCTCAG
GTGGGCACACGATCGGCGTGACGCACTGCGACAAGTTCGTG
CGGCGGCTGTACCCGTTCAAGGGCTCCCGAGGCGGCGCCGGCGGTGCGGGGCCGCCGATGAACCTCTACTTCCTGCGGCAGATGCGGCAGACGTGCCCGCTCAACTACAGCCCGTCGGCG
TTCGCGATGCTGGACGCCGTGACGCCGCGCAAGTTCGACAACGGCTACTACCAGACGCTGCAGCAGATGAAGGGCCTGCTCGCCTCCGACCAGGTCCTCTTCGCCGACCGCCGCTCCCGC
GCCACCGTCAACTACTTCGCCGCAAACCAGACCGCCTTCTTCGACGCCTTCGTCGCCGCCATGGCCAAGCTCGGCCGCGTCGGCGTCAAGACCGGATCCGATGGCGAGATCCGCCGGGTC
TGCACCAAGGTCAAC

Retrieve as FASTA