Entry information : SiPrx30 (Si006873m)
Entry ID 9528
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx30 (Si006873m)
Name (synonym) SiPrx30 (Si006873m)
Class Class III peroxidase    [Orthogroup: Prx052]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx30
start..stop
S start..stop
SbPrx145 606 0 1..329 1..329
SiPrx31 599 0 1..329 1..328
SbPrx129 598 0 1..329 5..332
SiPrx32 577 0 1..329 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14842255..14842476 222 N° 2 14841343..14842107 765  
complement(join(14841343..14842107,14842255..14842476))


exon

Literature and cross-references SiPrx30 (Si006873m)
DNA ref. Phytozome 12:   scaffold_4 (14842476..14841343)
Protein sequence: SiPrx30 (Si006873m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (302)
PWM (Da):   %s   35497.13 (32767.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.38 (7.06) Peptide Signal:   %s   cut: 28 range:28-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIKSCVLLLLPVALLLLAAGSSPAVAQLEIGYYSKTCPNVEAIVRDEMEKIISAAPSLAGPLLRLHFHDCFVRGCDASVLLNSTEGNLAERDAKPNKSLRGFGSVDRVKAKLEAACPNTVSCADVLTLMARDAVVLAKGPSWPVALGRRDGKVSSATEAADELPPANGDIPLLTKIFVSKNLDVKDLVVLSGAHTLGTAHCPSYAGRLYNFSSAYNADPTLDSEYADRLRTRCKSVDDKAMLSEMDPGSYKTFDTSYYRHVAKRRGLFQSDAALLTDAATRDYVQHIATGKFDDVFFKDFSESMIKMGNVGVLTGAEGEIRKKCYIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCAAGTCTTGTGTGCTGCTGTTGTTACCTGTGGCCCTTCTGCTGCTCGCAGCAGGCAGCTCACCGGCGGTGGCGCAGCTGGAGATCGGCTACTACAGCAAGACATGCCCCAAT
GTCGAGGCGATCGTCCGTGATGAGATGGAGAAGATCATCTCGGCCGCACCCAGCCTCGCCGGCCCGCTCCTCAGACTCCATTTCCACGACTGCTTCGTCAGG
GTAAGTTATATTACCCAG
TCCACCATGGCCTCACAAACTTTGAATATCCATCATGTACATGTATATTGCGTACTACATTGAGGTTTGCACCACTGATCGGTCACCATAGAACTGATAGAACAATGTGCTTACAACTCA
AAATTGCAGGGCTGTGATGCGTCTGTCCTTCTCAACTCCACCGAGGGCAACCTGGCAGAGAGGGACGCCAAGCCGAACAAGAGCCTCCGGGGATTTGGTTCCGTGGACAGGGTGAAGGCC
AAGCTCGAAGCCGCCTGCCCCAACACTGTCTCCTGCGCCGACGTCCTCACCCTCATGGCCCGCGACGCCGTCGTGCTTGCCAAGGGCCCATCCTGGCCGGTTGCGCTCGGGAGGCGAGAC
GGCAAGGTGTCCAGCGCCACAGAGGCGGCCGACGAGCTGCCTCCAGCCAACGGAGACATCCCTCTGCTCACAAAGATTTTCGTTTCCAAGAACCTCGATGTTAAGGACCTCGTCGTCCTC
TCTGGTGCGCACACCCTCGGCACGGCGCACTGCCCGTCCTACGCCGGCCGGCTCTACAACTTCAGCAGCGCCTACAACGCCGACCCAACCCTCGACAGCGAATACGCTGACAGGCTGAGG
ACGCGCTGCAAGAGCGTCGACGACAAGGCCATGCTGTCCGAGATGGACCCTGGCAGCTACAAGACCTTCGACACCAGCTACTACCGCCATGTCGCCAAGCGCCGGGGCCTCTTCCAGTCC
GACGCCGCACTCCTCACCGACGCCGCCACCAGGGATTACGTCCAGCACATCGCCACCGGCAAGTTCGATGACGTGTTCTTCAAGGACTTCAGTGAGTCCATGATCAAGATGGGCAACGTC
GGCGTTCTCACCGGTGCTGAGGGGGAGATCAGGAAAAAGTGCTACATCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCAAGTCTTGTGTGCTGCTGTTGTTACCTGTGGCCCTTCTGCTGCTCGCAGCAGGCAGCTCACCGGCGGTGGCGCAGCTGGAGATCGGCTACTACAGCAAGACATGCCCCAAT
GTCGAGGCGATCGTCCGTGATGAGATGGAGAAGATCATCTCGGCCGCACCCAGCCTCGCCGGCCCGCTCCTCAGACTCCATTTCCACGACTGCTTCGTCAGG
GGCTGTGATGCGTCTGTC
CTTCTCAACTCCACCGAGGGCAACCTGGCAGAGAGGGACGCCAAGCCGAACAAGAGCCTCCGGGGATTTGGTTCCGTGGACAGGGTGAAGGCCAAGCTCGAAGCCGCCTGCCCCAACACT
GTCTCCTGCGCCGACGTCCTCACCCTCATGGCCCGCGACGCCGTCGTGCTTGCCAAGGGCCCATCCTGGCCGGTTGCGCTCGGGAGGCGAGACGGCAAGGTGTCCAGCGCCACAGAGGCG
GCCGACGAGCTGCCTCCAGCCAACGGAGACATCCCTCTGCTCACAAAGATTTTCGTTTCCAAGAACCTCGATGTTAAGGACCTCGTCGTCCTCTCTGGTGCGCACACCCTCGGCACGGCG
CACTGCCCGTCCTACGCCGGCCGGCTCTACAACTTCAGCAGCGCCTACAACGCCGACCCAACCCTCGACAGCGAATACGCTGACAGGCTGAGGACGCGCTGCAAGAGCGTCGACGACAAG
GCCATGCTGTCCGAGATGGACCCTGGCAGCTACAAGACCTTCGACACCAGCTACTACCGCCATGTCGCCAAGCGCCGGGGCCTCTTCCAGTCCGACGCCGCACTCCTCACCGACGCCGCC
ACCAGGGATTACGTCCAGCACATCGCCACCGGCAAGTTCGATGACGTGTTCTTCAAGGACTTCAGTGAGTCCATGATCAAGATGGGCAACGTCGGCGTTCTCACCGGTGCTGAGGGGGAG
ATCAGGAAAAAGTGCTACATCGTCAAC

Retrieve as FASTA