Entry information : SiPrx32 (Si006881m)
Entry ID 9530
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx32 (Si006881m)
Name (synonym) SiPrx32 (Si006881m)
Class Class III peroxidase    [Orthogroup: Prx052]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx32
start..stop
S start..stop
SiPrx31 580 0 1..327 1..328
SiPrx30 576 0 1..327 1..329
SbPrx145 572 0 20..327 21..329
SbPrx129 564 0 1..327 5..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14902838..14903056 219 N° 2 14903154..14903915 762  
join(14902838..14903056,14903154..14903915)


exon

Literature and cross-references SiPrx32 (Si006881m)
DNA ref. Phytozome 12:   scaffold_4 (14902838..14903915)
Protein sequence: SiPrx32 (Si006881m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (301)
PWM (Da):   %s   35086.81 (32417.3)  
PI (pH):   %s   6.88 (6.51) Peptide Signal:   %s   cut: 27 range:27-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIKPCQVLLLPLALLLLAGSSPAAAQLEVGYYSKTCPNAEAIVRDEMEKIISAAPSLAGPLLRLHFHDCFVRGCDASVLLNSTEGNLAERDAKPNKSLRGFGSVDRVKAKLEAACPNTVSCADVLAIMARDAVVLAKGPSWPVPLGRRDGRVSSATEAADNLPPAFGDIPLLTKIFAANGLDLKDLVVLSGAHTLGTAHCPSYAARLYNFSAAGADPTLDSEYADRLRTRCKSVDDTAMLSETDPGSYKTFDTSYYRNLAKRRGLFQSDAALLTDATTREYVQRIATGKFDDMYFEDFGESMVKMGNAGVLTGAQGEIRKKCYIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATCAAGCCTTGTCAAGTACTGCTGCTCCCTTTGGCACTGCTGCTTCTGGCTGGCAGCTCGCCGGCGGCGGCCCAGCTGGAGGTCGGCTACTACAGCAAGACATGCCCGAACGCC
GAGGCGATCGTGCGCGACGAGATGGAGAAGATCATCTCCGCCGCGCCCAGCCTCGCCGGTCCCCTCCTCAGGCTCCATTTCCACGACTGCTTCGTCAGG
GTAAGTGTATGCCGTTTTCAG
TACAGAGAGACTTTCATTGATCATCGTCGTGTATTTAGTGCTTACACAAGCATGTGCTTGGAACGCAAAATTTCAGGGCTGTGATGCTTCCGTCCTACTCAACTCCACCGAGGGAAACCT
GGCAGAGAGGGACGCCAAGCCCAACAAGAGCCTCCGGGGCTTCGGTTCCGTGGACAGGGTGAAGGCCAAGCTCGAGGCCGCCTGCCCCAACACCGTCTCCTGCGCCGACGTCCTCGCCAT
CATGGCCCGCGACGCCGTCGTGCTTGCCAAGGGCCCATCCTGGCCTGTTCCGCTCGGCAGGAGGGACGGCAGGGTGTCGAGCGCCACGGAAGCCGCCGACAACCTGCCCCCTGCCTTCGG
CGACATCCCCCTCCTCACCAAGATCTTCGCCGCCAACGGGCTCGACCTCAAGGACCTCGTCGTCCTCTCCGGCGCGCACACTCTCGGGACGGCGCACTGCCCGTCCTACGCCGCCCGGCT
CTACAACTTCAGCGCCGCTGGCGCGGACCCGACGCTCGACAGCGAGTACGCCGACAGGCTGAGGACGCGCTGCAAGAGCGTCGACGACACGGCCATGCTCTCCGAGACGGACCCCGGCAG
CTACAAGACCTTCGACACCAGTTACTACCGCAACCTCGCCAAGCGCAGGGGGCTCTTCCAGTCCGACGCAGCGCTGCTCACCGACGCCACCACCAGGGAGTACGTCCAGCGCATCGCCAC
CGGCAAGTTCGACGACATGTACTTCGAGGACTTCGGCGAGTCCATGGTCAAGATGGGAAACGCCGGCGTGCTCACCGGTGCTCAGGGCGAGATCAGGAAGAAGTGCTATATCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAATCAAGCCTTGTCAAGTACTGCTGCTCCCTTTGGCACTGCTGCTTCTGGCTGGCAGCTCGCCGGCGGCGGCCCAGCTGGAGGTCGGCTACTACAGCAAGACATGCCCGAACGCC
GAGGCGATCGTGCGCGACGAGATGGAGAAGATCATCTCCGCCGCGCCCAGCCTCGCCGGTCCCCTCCTCAGGCTCCATTTCCACGACTGCTTCGTCAGG
GGCTGTGATGCTTCCGTCCTA
CTCAACTCCACCGAGGGAAACCTGGCAGAGAGGGACGCCAAGCCCAACAAGAGCCTCCGGGGCTTCGGTTCCGTGGACAGGGTGAAGGCCAAGCTCGAGGCCGCCTGCCCCAACACCGTC
TCCTGCGCCGACGTCCTCGCCATCATGGCCCGCGACGCCGTCGTGCTTGCCAAGGGCCCATCCTGGCCTGTTCCGCTCGGCAGGAGGGACGGCAGGGTGTCGAGCGCCACGGAAGCCGCC
GACAACCTGCCCCCTGCCTTCGGCGACATCCCCCTCCTCACCAAGATCTTCGCCGCCAACGGGCTCGACCTCAAGGACCTCGTCGTCCTCTCCGGCGCGCACACTCTCGGGACGGCGCAC
TGCCCGTCCTACGCCGCCCGGCTCTACAACTTCAGCGCCGCTGGCGCGGACCCGACGCTCGACAGCGAGTACGCCGACAGGCTGAGGACGCGCTGCAAGAGCGTCGACGACACGGCCATG
CTCTCCGAGACGGACCCCGGCAGCTACAAGACCTTCGACACCAGTTACTACCGCAACCTCGCCAAGCGCAGGGGGCTCTTCCAGTCCGACGCAGCGCTGCTCACCGACGCCACCACCAGG
GAGTACGTCCAGCGCATCGCCACCGGCAAGTTCGACGACATGTACTTCGAGGACTTCGGCGAGTCCATGGTCAAGATGGGAAACGCCGGCGTGCTCACCGGTGCTCAGGGCGAGATCAGG
AAGAAGTGCTATATCGTCAAC

Retrieve as FASTA