Entry information : SiPrx39 (Si007943m)
Entry ID 9537
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx39 (Si007943m)
Name (synonym) SiPrx39 (Si007943m)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx39
start..stop
S start..stop
HvPrx16 643 0 1..334 1..334
SofPrx09 637 0 1..334 1..340
SbPrx128 636 0 1..334 2..344
FpPrx01 634 0 1..334 1..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12552330..12552563 234 N° 2 12551993..12552184 192 N° 3 12551590..12551755 166 N° 4 12550938..12551347 410
complement(join(12550938..12551347,12551590..12551755,12551993..12552184,1255233 0..12552563))


exon

Literature and cross-references SiPrx39 (Si007943m)
DNA ref. Phytozome 12:   scaffold_4 (12552563..12550938)
Protein sequence: SiPrx39 (Si007943m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (307)
PWM (Da):   %s   36509.84 (33661.3) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.64 (4.58) Peptide Signal:   %s   cut: 28 range:28-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATGALCFRAFALSMACLLLAVPLLVAQDPSKLSLEYYSKTCPNVEHVVRTEMECAVRADTRNAALMLRLHFHDCFVQGCDGSVLLDDTATMIGEKQADQNVNSLKGFELVDKIKEKLEAECPGTVSCADLLAIAARDAVVLVGGPYWDVPVGRLDSKKASLDLANSDIPTAQQGLVTLIAKFWQKGLDATDMVALVGSHTIGFARCENFRDRIYGDFEMTSKYNPSSETYLSKLKEVCPQDSGDDNISAMDSHTSAIFDNAYYETLIKGEGLLNSDQEMWSSIAGYSTADTVNKYWADPAAFFKQFSDSMVKMGNITNPAGGEVRKNCRFVNT*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACAGGCGCGCTGTGCTTCAGGGCGTTTGCCCTCTCGATGGCCTGCCTTCTCCTTGCTGTGCCGCTGCTAGTGGCTCAAGACCCTTCAAAGCTGAGCCTGGAGTACTACTCCAAG
ACATGCCCGAATGTGGAGCACGTCGTCCGTACGGAGATGGAGTGCGCAGTGCGTGCAGATACCCGCAATGCTGCCCTGATGCTTCGCCTACATTTCCATGACTGCTTCGTGCAG
GTCAGT
ACTCTGTTCTTATTTACTCCAGACACTGATCAACCTCTTTGTTTACCATGCACACCAGGAGCTGGAATTGGTATCAGCCAATGCAGCACTCTGACAAAGGTGGCTTGCTGAACATCTGAA
TTCTGAACGGTTCTTGCAGGGATGTGATGGATCAGTGCTGCTTGATGACACCGCGACCATGATCGGGGAGAAGCAGGCAGACCAGAACGTCAATTCGCTGAAAGGATTTGAGCTGGTCGA
CAAGATCAAGGAGAAGCTGGAAGCTGAGTGCCCTGGAACTGTTTCTTGCGCAGACTTGCTCGCCATTGCAGCTAGGGACGCGGTTGTGCTG
GTAAATCAAACCACATCTATTTTCAGTTT
CCAACTCTATGACTTGCATCTGCGAAATAACTAGTCCCTAAAAATTAGTATTATATCATGCATTAACTTTATTTTAGATTGAAACAATTTCAAATGTGGATACACTCTGAAAGTTTCATA
ATTAGGCTTGTTATTCGAGCAAAAAGAACTTTGAAATAAAAGTCAGTATATACTATCCATGTTACAGAGATGAAAACAATGGTTGCAGGTAGGTGGGCCTTACTGGGACGTCCCAGTAGG
AAGATTGGACTCCAAGAAGGCAAGCCTGGACCTAGCAAACAGTGACATCCCCACGGCTCAGCAGGGCCTTGTCACCCTCATCGCCAAGTTCTGGCAGAAAGGCCTTGATGCCACCGACAT
GGTGGCCCTTGTTG
GTATGTTCCTCTCTTTTAGAGGCTGCAGTTTAAAATCATAATCACAACTTAAATTAAGATCAACAAACCCTGGCGATGAGGTGCTACGAGAAATGATAAAAAATTC
AGGAAATGATTAACTCGTAAACATTACAGTTATATATCGAATACAGTCACATACAAGCATATTTTTATTATTGTGCAGATTATATTTGACTAATTTCCTATACACCTGACTAAATGTGTA
TCACGTGCATTTTAAGGCTCCCACACGATCGGATTTGCCAGGTGCGAGAATTTCCGAGACAGAATCTATGGCGACTTTGAGATGACGTCCAAGTACAATCCGTCATCCGAGACATACCTC
AGCAAGCTGAAAGAGGTCTGCCCCCAGGACAGCGGTGACGACAACATCAGCGCCATGGACAGTCACACCTCCGCAATCTTTGACAATGCCTACTACGAGACGCTCATCAAGGGCGAAGGC
CTCCTCAACTCCGACCAGGAGATGTGGTCCAGCATCGCCGGCTACTCGACGGCTGACACCGTGAACAAGTACTGGGCTGACCCCGCTGCATTCTTCAAGCAGTTCTCCGACTCCATGGTG
AAGATGGGCAACATCACCAACCCTGCCGGCGGCGAGGTCAGGAAGAACTGCAGATTTGTCAACACA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCACAGGCGCGCTGTGCTTCAGGGCGTTTGCCCTCTCGATGGCCTGCCTTCTCCTTGCTGTGCCGCTGCTAGTGGCTCAAGACCCTTCAAAGCTGAGCCTGGAGTACTACTCCAAG
ACATGCCCGAATGTGGAGCACGTCGTCCGTACGGAGATGGAGTGCGCAGTGCGTGCAGATACCCGCAATGCTGCCCTGATGCTTCGCCTACATTTCCATGACTGCTTCGTGCAG
GGATGT
GATGGATCAGTGCTGCTTGATGACACCGCGACCATGATCGGGGAGAAGCAGGCAGACCAGAACGTCAATTCGCTGAAAGGATTTGAGCTGGTCGACAAGATCAAGGAGAAGCTGGAAGCT
GAGTGCCCTGGAACTGTTTCTTGCGCAGACTTGCTCGCCATTGCAGCTAGGGACGCGGTTGTGCTG
GTAGGTGGGCCTTACTGGGACGTCCCAGTAGGAAGATTGGACTCCAAGAAGGCA
AGCCTGGACCTAGCAAACAGTGACATCCCCACGGCTCAGCAGGGCCTTGTCACCCTCATCGCCAAGTTCTGGCAGAAAGGCCTTGATGCCACCGACATGGTGGCCCTTGTTG
GCTCCCAC
ACGATCGGATTTGCCAGGTGCGAGAATTTCCGAGACAGAATCTATGGCGACTTTGAGATGACGTCCAAGTACAATCCGTCATCCGAGACATACCTCAGCAAGCTGAAAGAGGTCTGCCCC
CAGGACAGCGGTGACGACAACATCAGCGCCATGGACAGTCACACCTCCGCAATCTTTGACAATGCCTACTACGAGACGCTCATCAAGGGCGAAGGCCTCCTCAACTCCGACCAGGAGATG
TGGTCCAGCATCGCCGGCTACTCGACGGCTGACACCGTGAACAAGTACTGGGCTGACCCCGCTGCATTCTTCAAGCAGTTCTCCGACTCCATGGTGAAGATGGGCAACATCACCAACCCT
GCCGGCGGCGAGGTCAGGAAGAACTGCAGATTTGTCAACACA

Retrieve as FASTA