Entry information : SiPrx47 (Si010431m)
Entry ID 9545
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx47 (Si010431m)
Name (synonym) SiPrx47 (Si010431m)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx47
start..stop
S start..stop
SbPrx116 586 0 4..362 10..363
ZmPrx03_B73 578 0 2..362 3..360
ZmPrx03_Du101 577 0 2..362 1..357
ZmPrx03_Lan496 576 0 2..362 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32260908..32261114 207 N° 2 32260268..32260726 459 N° 3 32259762..32260181 420  
complement(join(32259762..32260181,32260268..32260726,32260908..32261114))


exon

Literature and cross-references SiPrx47 (Si010431m)
DNA ref. Phytozome 12:   scaffold_7 (32261114..32259762)
Protein sequence: SiPrx47 (Si010431m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (340)
PWM (Da):   %s   38666.51 (36172.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.89 (6.65) Peptide Signal:   %s   cut: 23 range:23-362
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTRKRCYLRFATLLAGLLSAAACLDFGFYDRMCPAAETIVQQTVADAFRNNSGVAPALIRLHFHDCFVRGCDGSVLIDSTTNPNNTAEKDAPPNNPSLRFFDVIDRAKAAVEAQCPGVVSCADILAFAARDSVVLSGGLGYQLPAGRRDGRISRDTDALNDLPPPFFNATQLADSFASKNLTVEDLVVLSGAHTIGVSHCSSFAGVPDNPADRLYNFSSPEKIDPALSKAYAFLLKSICPSNSSQFFPTTTTLMDLITPDKLDNKYYVGLTNNLGLFISDAALLTNATMKALVDSFVRSEATWKAKFARSMLKMGQIGVLTGTQGEIRRNCRVVNPAPRTAAGVHRVVAGSDSSGFTGVAAS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGGAAGCGCTGCTACCTACGCTTCGCAACGCTCCTGGCGGGGCTCCTCTCGGCCGCCGCCTGCCTCGACTTCGGCTTCTACGACAGGATGTGCCCCGCCGCCGAGACCATCGTG
CAGCAGACCGTCGCCGACGCGTTCAGAAACAACTCCGGCGTCGCTCCGGCGCTGATCCGCTTGCACTTCCATGACTGCTTCGTCAGA
GTAAGCACATGCACATAAGAAAAGTTCTGAAAA
ATATGATGAAATGGAAGTATATATTTTGCATAACAGTTCTAGATACCATTTCTATGTCACAAAGCTTGTCACTATTATTGTGAGGTCGTGAGGAAGTAAAGGATTTCACCTGAGAGTGAC
GGCACCGACGCTTAAACCTCCTTTGCAGGGCTGCGACGGCTCGGTGCTGATCGACTCGACGACGAACCCGAACAACACGGCGGAGAAGGACGCGCCGCCCAACAACCCCAGCCTCCGGTT
CTTCGACGTGATCGACCGCGCCAAGGCGGCCGTCGAGGCGCAGTGCCCCGGTGTGGTCTCCTGCGCCGACATCCTCGCCTTCGCGGCCCGGGACAGCGTCGTGCTCTCCGGCGGCCTCGG
CTACCAGCTGCCGGCCGGGCGCCGTGACGGCCGGATATCCCGCGACACGGACGCGCTCAACGACCTGCCCCCGCCCTTCTTCAACGCCACCCAGCTCGCCGACAGCTTCGCCTCCAAGAA
CCTCACCGTCGAGGACCTCGTCGTCCTCTCCGGCGCCCACACCATCGGCGTCTCCCACTGCAGCAGCTTCGCCGGCGTCCCCGACAATCCTGCCGACCGCCTGTACAACTTCAGCTCGCC
TGAAAAG
GTAAGCATACCCACTTACCACATGCATGAAGTGAAGACGTTCTTACCCATTCACCAAATTACCATTGCTGTGAGGCGGGTACACAGATTGATCCGGCACTGAGCAAGGCCTAC
GCGTTTCTGCTCAAGAGCATCTGCCCATCGAACAGCAGCCAGTTCTTCCCGACGACGACGACGCTCATGGACCTCATCACGCCGGACAAGCTCGACAACAAGTACTACGTCGGCCTGACC
AACAACCTGGGCCTCTTCATATCGGACGCGGCGCTGCTGACCAACGCGACGATGAAGGCGCTGGTCGACTCCTTCGTGCGCAGCGAGGCCACGTGGAAGGCCAAGTTCGCCAGGTCCATG
CTCAAGATGGGGCAGATTGGGGTGCTGACTGGAACGCAGGGAGAGATCAGGCGCAACTGCAGGGTCGTCAACCCTGCTCCTCGTACCGCTGCAGGCGTTCATCGTGTTGTCGCCGGATCT
GATTCTTCAGGATTCACTGGCGTGGCTGCAAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGAGGAAGCGCTGCTACCTACGCTTCGCAACGCTCCTGGCGGGGCTCCTCTCGGCCGCCGCCTGCCTCGACTTCGGCTTCTACGACAGGATGTGCCCCGCCGCCGAGACCATCGTG
CAGCAGACCGTCGCCGACGCGTTCAGAAACAACTCCGGCGTCGCTCCGGCGCTGATCCGCTTGCACTTCCATGACTGCTTCGTCAGA
GGCTGCGACGGCTCGGTGCTGATCGACTCGACG
ACGAACCCGAACAACACGGCGGAGAAGGACGCGCCGCCCAACAACCCCAGCCTCCGGTTCTTCGACGTGATCGACCGCGCCAAGGCGGCCGTCGAGGCGCAGTGCCCCGGTGTGGTCTCC
TGCGCCGACATCCTCGCCTTCGCGGCCCGGGACAGCGTCGTGCTCTCCGGCGGCCTCGGCTACCAGCTGCCGGCCGGGCGCCGTGACGGCCGGATATCCCGCGACACGGACGCGCTCAAC
GACCTGCCCCCGCCCTTCTTCAACGCCACCCAGCTCGCCGACAGCTTCGCCTCCAAGAACCTCACCGTCGAGGACCTCGTCGTCCTCTCCGGCGCCCACACCATCGGCGTCTCCCACTGC
AGCAGCTTCGCCGGCGTCCCCGACAATCCTGCCGACCGCCTGTACAACTTCAGCTCGCCTGAAAAG
ATTGATCCGGCACTGAGCAAGGCCTACGCGTTTCTGCTCAAGAGCATCTGCCCA
TCGAACAGCAGCCAGTTCTTCCCGACGACGACGACGCTCATGGACCTCATCACGCCGGACAAGCTCGACAACAAGTACTACGTCGGCCTGACCAACAACCTGGGCCTCTTCATATCGGAC
GCGGCGCTGCTGACCAACGCGACGATGAAGGCGCTGGTCGACTCCTTCGTGCGCAGCGAGGCCACGTGGAAGGCCAAGTTCGCCAGGTCCATGCTCAAGATGGGGCAGATTGGGGTGCTG
ACTGGAACGCAGGGAGAGATCAGGCGCAACTGCAGGGTCGTCAACCCTGCTCCTCGTACCGCTGCAGGCGTTCATCGTGTTGTCGCCGGATCTGATTCTTCAGGATTCACTGGCGTGGCT
GCAAGC

Retrieve as FASTA