Entry information : SiAPx10 ( Si010452m)
Entry ID 9546
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2012-03-21 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-31 (Christophe Dunand)
Peroxidase information: SiAPx10 ( Si010452m)
Name (synonym) SiAPx10 ( Si010452m)
Class Ascorbate peroxidase    [Orthogroup: APx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiAPx10
start..stop
S start..stop
SbAPx03 509 0 4..291 2..289
ZmAPx03 501 0 4..291 2..289
OsAPx03 492 2e-178 4..292 3..291
BdiAPx06 475 1e-171 1..291 1..293
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5082050..5082168 119 N° 2 5082255..5082379 125 N° 3 5082524..5082573 50 N° 4 5082647..5082712 66
N° 5 5082806..5082854 49 N° 6 5083089..5083171 83 N° 7 5083331..5083410 80 N° 8 5083525..5083627 103
N° 9 5083884..5084084 201  
join(5082050..5082168,5082255..5082379,5082524..5082573,5082647..5082712,5082806 ..5082854,5083089..5083171,5083331..5083410,5083525..5083627,5083884..5084084)


exon

Literature and cross-references SiAPx10 ( Si010452m)
DNA ref. Phytozome 11:   scaffold_7 (5082050..5084084)
Protein sequence: SiAPx10 ( Si010452m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   293
PWM (Da):   %s   31961.15 Transmb domain:   %s   o263-285i
PI (pH):   %s   7.15
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSEAAPMVDSEYMAEIEKARRDLRALIASKNCAPIMLRLAWHDAGTYDAKTKTGGPNGSIRFQQEYSHGANAGIKIAIDLLEPIKQKHPKITYADLYQLAGVVAVEVTGGPTIDFVPGRKDSSVCPEEGRLPDAKQGASHIRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGAWTKDPLKFDNSYFVELLKGDSEGLLKLPTDKALVEDPEFRCYVEKYAKDEEAFFRDYAESHKKLSEMCFTPPRSAFSCKSGNKQKSLLVQAAAGVAVAAAVVAWAYLCESNKKIG*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from Phytozome (Extra 5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCAGAGGCAGCGCCCATGGTGGACTCAGAGTACATGGCGGAGATCGAGAAGGCACGGCGGGACCTCCGTGCCCTCATCGCCAGCAAGAATTGCGCACCCATCATGCTCCGCCTAGCG
TACGTCCTCAGCCTCATGTCCCCCATGTGTGGTCTAATTTGCAAACATTTCCTTGCGGAACAACCAATGGCGATCGGTCTTGCAGATGGCATGACGCCGGCACTTACGACGCCAAGACCA
AGACTGGAGGCCCCAACGGCTCCATTAGGTTCCAGCAGGAGTACAGCCACGGCGCAAATGCAGGGATCAAGATTGCCATTGACCTTTTAG
GTCAGTACTTCTTCCATCAGATACATCTTG
CTCCTCTCTGTAGTCCCAAGTGAATATATTTGGAGTAGCCTCCTGGTGCTTTTGAAACGCCTATCATCAAATGGATGAAGTCTTAACACCCTAGTCCTGCTTCCTCCTGCGCAGAGCCAA
TAAAACAGAAGCACCCCAAGATCACATATGCAGACCTGTATCAG
GTAACACAACTACATCCGCACAGATTATTACTCAATGATATCATACCATATCTAATACTGTTTTGCTGACCAGCTC
GCTGGAGTTGTTGCCGTCGAAGTTACTGGTGGACCAACCATCGATTTCGTTCCTGGCAGGAAG
GTGAGTCAGTACACGAGATTACCACACTTTATCAGCGAAACGAAAGGAGTATATCAT
GTCAAAGTTTCTTACTACCTTTCCATGTTTGACCAGGATTCTTCAGTTTGTCCAGAGGAAGGACGCTTGCCGGATGCAAAGCAAGGTAGCTTCCCAACACATCACTGGCACTATCTAGTA
CAGTGCTGTTCAATGATTTTCAATATGATCTTTCAACATATGTTTGCTCTTTCCGAACGAAACAAGGGCTACAACCTCGCAATTGGAAATTTGCAACGCAAAAGAATCCTGCTGATCTAC
TGTAAATAAGAGGTTGCTTCCAACAAAATTACTGATAATGTTTATTTTTCTTTTTCTTGAACTTTGTATTGGTGCTTAGGTGCTTCGCACATTCGAGACGTCTTCTACCGGATGGGCTTG
TCTGACAAGGACATAGTGGCACTTTCTGGTGGCCATACTCTG
GTATATAACATAATAATACTGTTTTCATGTACATGTATATAGCAAGCACGTTTGTTTTGAGTATTGAAAGGTTAAAAA
GGATTAACATGCTCTGAATTAGAGTATCATAGTTGATTCTTATTTTATTTGAAATGTGCATCCCGATGATACAATTTTCAGGGCAGGGCACATCCAGAGAGGTCAGGATTTGATGGAGCA
TGGACTAAAGATCCACTGAAATTTGACAATTCCTATTTCGT
GTAAGCCTTGCCTAAATATCACTTGTTCAACAAATAGGAGCAGGATTGTATTACCTTTTTCTTTTAAGATTGTGCAGTA
ATGTCACACTGTTTTCGTCGCTTTGTATGATACAGTGAACTGCTGAAAGGTGACTCTGAAGGGCTCTTGAAGCTCCCTACTGACAAGGCTCTTGTGGAAGATCCTGAATTCCGGTGCTAT
GTTGAAAAATATGCCAAG
GTTCATACAATTCAGTTCCCATCTTCCATTCATGCTCCAACGGCTCCTGAAACAGTAGTAGTTGTTTTCTCATAAGCTCGAATTGTTTAGCCAAAGCATCTA
TCAGGTTGATAGTGATACTTTTTGCATTTTATTTACTTTTGATTTTCTGCCCATGGAGTGACAAAATTCCTGCAATCTTAAACTTCAATACTAAAAATACTTGACATTAATCCTTGTTAG
TTCACTGAACATTTTTTTCAATCTTCACTCGCAGGATGAAGAGGCCTTCTTTAGGGACTACGCAGAATCACACAAGAAGCTCTCCGAGATGTGCTTCACGCCCCCTCGCTCTGCTTTCTC
GTGCAAATCCGGAAATAAACAGAAGTCCTTGCTGGTACAAGCTGCAGCTGGGGTTGCAGTTGCTGCTGCAGTTGTCGCATGGGCATACCTCTGCGAATCCAACAAGAAGATTGGC

Retrieve as FASTA