Entry information : SiPrx50 (Si010487m)
Entry ID 9547
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx50 (Si010487m)
Name (synonym) SiPrx50 (Si010487m)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx50
start..stop
S start..stop
SbPrx94 613 0 1..347 4..347
ZmPrx140 582 0 1..347 1..352
OsPrx56 547 0 1..347 1..328
BdiPrx132 541 0 1..347 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30603063..30603323 261 N° 2 30603419..30603607 189 N° 3 30603908..30604076 169 N° 4 30604438..30604859 422
join(30603063..30603323,30603419..30603607,30603908..30604076,30604438..30604859 )


exon

Literature and cross-references SiPrx50 (Si010487m)
DNA ref. Phytozome 12:   scaffold_7 (30603063..30604859)
Protein sequence: SiPrx50 (Si010487m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   348 (325)
PWM (Da):   %s   37599.15 (35039.7)  
PI (pH):   %s   8.39 (8.21) Peptide Signal:   %s   cut: 23 range:23-347
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIFRLLFGLVLALFLQSLSVLANPLELGLQSSSSGLPNPSGLRVGFYQYTCPNAEAIVRDEMTKIISQVPSLAGPLLRMHFHDCFVNGCDGSILLNSVWGLPSEKEAIPNLSLRGFGTIDRVKAKLEKACPGVVSCADILALVARDVVVLTKGPHWDVPTGRRDGRRSVKQDALDNLPPPFFNAGQNLYQFFIPKGLDAKDQVVLLGGHTLGTSHCSQFADRLYNFSGTTMPDPSLDKRYIPRLKSKCASPGDTTTLVEMDPGSFRTFDASYYRHVARGRSLFTSDQTLMNDPAAGAYVRRQAAVADAGAYPAEFFADFAASMVKMGGVGVLTGAQGEVRRHCAFVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTCAGACTCCTCTTTGGACTTGTCCTTGCCCTATTCCTACAATCCTTATCAGTGCTAGCCAATCCATTAGAATTAGGACTACAATCCTCATCGTCAGGGCTACCCAATCCATCG
GGGCTGAGGGTTGGATTTTACCAGTACACATGTCCGAATGCGGAGGCCATTGTTCGTGATGAGATGACCAAGATCATCTCTCAAGTCCCAAGTCTCGCTGGCCCGCTGCTTCGGATGCAT
TTCCATGACTGCTTTGTGAAT
GTAAGTGTGATCATTTTATTCTGTTCTGAACTGTTTCAGCTGTGTTCAGACTTCAAAAGGTATGTGACTGAAGAATTGAATGTGCTATGCTGCAGGGTT
GCGATGGTTCAATTTTGCTGAATAGCGTATGGGGATTACCATCCGAGAAGGAGGCGATACCGAACCTCAGCCTGCGAGGCTTTGGCACGATCGACCGCGTCAAGGCGAAGCTGGAGAAGG
CCTGCCCTGGAGTGGTGTCCTGTGCTGATATCCTGGCTCTGGTAGCAAGGGATGTCGTTGTACTG
GTAAGAGATTAGTACAAGTCTTGTTTGTTGATCTTCGTTTATCAGTTCTTTTCTT
AGGGGAATTTGGCTTGTTAATTCTTCAAGTAGGAGATGTTAACCTATTTTGCTTAAGTGACTCCCCTAATTGGCTGTGTCAATGGCAGCAAAATCTTTCACTGAATTGAGTTTGATCGTC
TTCATGTAGTTAGTGGCCAGTAGTCTCCCTTACTTTTGACAATGACTCTTTTTTAAAAAACTTTTGACAATGAATCAATGACTGACGTTAATCCAATGTCTGTTTACCTTTTTCCTGTGC
AACAGACGAAAGGGCCTCATTGGGATGTCCCAACTGGGCGTAGAGATGGGAGGAGATCAGTGAAGCAAGATGCCTTGGACAATCTCCCTCCTCCCTTCTTTAATGCCGGTCAGAACCTGT
ACCAGTTCTTCATCCCCAAGGGCCTTGACGCAAAGGATCAGGTGGTTCTACTAG
GTAATACACTACTCGCCACATCCTCAACTTGATGCATTATCGTCAATAAAGAAAGAGAGTACCTAG
ATGATTGGTGCTGGCTCTTTCCTGGTTTTTGTTTAAACCCCATGCTGATCCCAACAAATCCGTGGTAGTAGCGCGCGTTCTCCAATAAAGGTGATACTTTGTAGAGCAACTGTGAAGCAA
CTTGTTCATGAAAAGAAGGCAAAGTCAACAGAATCGGGATTAAATTCTTGTAACTGTAACATGTGCTTACCGTGTTGTTCATATAATCATGTACTCTCTCATAGTCTCATGATCATGTTC
ATATCTGCATGGTTACTGAAACTGAGAGACTCCTGTGTCTGTTGATCTGCAACAGGGGGTCACACACTTGGGACCTCCCACTGCTCGCAGTTCGCCGACCGGCTCTACAACTTCAGCGGC
ACGACGATGCCGGACCCGTCCCTGGACAAGCGCTACATCCCGCGGCTGAAGAGCAAGTGCGCCAGCCCCGGCGACACGACGACGCTGGTGGAGATGGACCCGGGCAGCTTCCGGACGTTC
GACGCGAGTTACTACAGGCACGTGGCCAGGGGCAGGTCCCTCTTCACCTCCGACCAGACGCTCATGAACGACCCCGCCGCCGGGGCCTACGTCCGGCGGCAGGCCGCCGTGGCCGACGCC
GGCGCCTACCCGGCCGAGTTCTTCGCCGACTTCGCGGCGTCCATGGTGAAGATGGGCGGCGTGGGGGTGCTCACCGGCGCGCAGGGGGAGGTCCGGAGGCACTGCGCGTTCGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTTCAGACTCCTCTTTGGACTTGTCCTTGCCCTATTCCTACAATCCTTATCAGTGCTAGCCAATCCATTAGAATTAGGACTACAATCCTCATCGTCAGGGCTACCCAATCCATCG
GGGCTGAGGGTTGGATTTTACCAGTACACATGTCCGAATGCGGAGGCCATTGTTCGTGATGAGATGACCAAGATCATCTCTCAAGTCCCAAGTCTCGCTGGCCCGCTGCTTCGGATGCAT
TTCCATGACTGCTTTGTGAAT
GGTTGCGATGGTTCAATTTTGCTGAATAGCGTATGGGGATTACCATCCGAGAAGGAGGCGATACCGAACCTCAGCCTGCGAGGCTTTGGCACGATCGAC
CGCGTCAAGGCGAAGCTGGAGAAGGCCTGCCCTGGAGTGGTGTCCTGTGCTGATATCCTGGCTCTGGTAGCAAGGGATGTCGTTGTACTG
ACGAAAGGGCCTCATTGGGATGTCCCAACT
GGGCGTAGAGATGGGAGGAGATCAGTGAAGCAAGATGCCTTGGACAATCTCCCTCCTCCCTTCTTTAATGCCGGTCAGAACCTGTACCAGTTCTTCATCCCCAAGGGCCTTGACGCAAAG
GATCAGGTGGTTCTACTAG
GGGGTCACACACTTGGGACCTCCCACTGCTCGCAGTTCGCCGACCGGCTCTACAACTTCAGCGGCACGACGATGCCGGACCCGTCCCTGGACAAGCGCTAC
ATCCCGCGGCTGAAGAGCAAGTGCGCCAGCCCCGGCGACACGACGACGCTGGTGGAGATGGACCCGGGCAGCTTCCGGACGTTCGACGCGAGTTACTACAGGCACGTGGCCAGGGGCAGG
TCCCTCTTCACCTCCGACCAGACGCTCATGAACGACCCCGCCGCCGGGGCCTACGTCCGGCGGCAGGCCGCCGTGGCCGACGCCGGCGCCTACCCGGCCGAGTTCTTCGCCGACTTCGCG
GCGTCCATGGTGAAGATGGGCGGCGTGGGGGTGCTCACCGGCGCGCAGGGGGAGGTCCGGAGGCACTGCGCGTTCGTGAAC

Retrieve as FASTA