Entry information : SiPrx53 (Si010572m)
Entry ID 9549
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx53 (Si010572m)
Name (synonym) SiPrx53 (Si010572m)
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx53
start..stop
S start..stop
ZmPrx130 562 0 13..331 16..334
SbPrx106 559 0 28..331 37..341
OsPrx137 527 0 8..331 5..327
ZmPrx131 516 0 22..331 27..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32707674..32707895 222 N° 2 32708037..32708222 186 N° 3 32708297..32708459 163 N° 4 32708527..32708948 422
join(32707674..32707895,32708037..32708222,32708297..32708459,32708527..32708948 )


exon

Literature and cross-references SiPrx53 (Si010572m)
DNA ref. Phytozome 11:   scaffold_7 (32707674..32708948)
Protein sequence: SiPrx53 (Si010572m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (304)
PWM (Da):   %s   34148.02 (31538.6) Transmb domain:   %s   i2-24o
PI (pH):   %s   4.21 (4.17) Peptide Signal:   %s   cut: 28 range:28-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVSGAAAAALAMAVLLFLGIIGVARGQLQVGFYSDSCPDAEDTVTAAVQDAANNDPTILPALLRLQFHDCFVKGCDASVLIRSASNDAEVDNSKNQGLRGQDVVDAAKAQLEDQCPGVVSCADIIALAARDAVALTGGPTFDVPTGRRDGLTSNLRDADVLPDAADSINVLRSSFAAAGLNDRDLVLLTAAHTVGTTACFFVKDRLYSFPLPGGKAGSDPSIPAAFVAELKARCPPGDFNTRLPLDRGSESDFDDSILRNIRSGLAVIASDAALANSNATRALVDAYLGPAAGSFERDFAAAMVRMGSIGAITGDDDGEIRDVCSAFNT

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGTCCGGAGCGGCGGCGGCTGCGCTAGCGATGGCGGTGTTGCTGTTTCTTGGGATCATTGGCGTCGCGCGTGGCCAGCTGCAGGTGGGGTTCTACTCCGACTCCTGCCCGGAC
GCCGAGGACACGGTCACCGCCGCCGTCCAGGACGCCGCCAACAACGACCCCACCATCCTCCCCGCGCTGCTCCGCCTCCAGTTCCACGACTGCTTCGTCAAG
GTACGTACCGTACCTGAC
CGCGTGCGCCGTTGCTTGCGTGTGTTTCCAAGCCCGGCCGATTGTTTACGTGTTTCCTCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAACGGAATGGTGGCATTAATAATTTG
CAGGGGTGCGACGCGTCGGTGCTGATCAGGAGCGCAAGCAACGACGCCGAGGTGGACAACAGCAAGAACCAGGGCCTGCGCGGCCAGGACGTGGTCGACGCCGCCAAGGCGCAGCTCGAG
GACCAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCATCGCCCTCGCCGCACGCGACGCCGTCGCCCTG
GTAATCGACAATTATCAACGTTGTATTCTGCGTGTTTGGCTTACTGACGCA
GTTCATTGCATGCCATGGATCAGACGGGCGGGCCGACGTTCGACGTGCCAACGGGGCGGCGCGACGGCCTGACTTCCAACCTCCGCGACGCCGACGTGCTGCCGGACGCCGCCGACTCCA
TCAACGTGCTCCGCTCAAGCTTCGCCGCCGCCGGCCTCAACGACCGAGATCTCGTCCTCCTCACAG
GTATATAGCTACATTCACATGCACACGTGCACGGACGTCGAGGCACTGACACTC
GGTGACGGTGCAGCGGCGCACACGGTGGGCACGACGGCGTGCTTCTTCGTGAAGGACCGGCTGTACAGCTTCCCTCTCCCGGGCGGCAAGGCGGGGTCGGACCCGTCGATCCCGGCGGCG
TTCGTGGCGGAGCTCAAGGCCCGGTGCCCGCCGGGGGACTTCAACACGCGGCTGCCGCTGGACCGCGGCAGCGAGAGCGACTTCGACGACTCCATCCTCCGCAACATCCGGTCGGGGCTC
GCCGTCATCGCCTCCGACGCCGCGCTCGCCAACAGCAACGCCACCCGCGCGCTCGTCGACGCGTACCTGGGCCCCGCGGCGGGGAGCTTCGAGCGGGACTTCGCCGCCGCCATGGTCAGG
ATGGGCAGCATCGGCGCCATCACCGGCGACGATGACGGCGAGATCAGGGACGTCTGCTCCGCATTCAACACCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGTGTCCGGAGCGGCGGCGGCTGCGCTAGCGATGGCGGTGTTGCTGTTTCTTGGGATCATTGGCGTCGCGCGTGGCCAGCTGCAGGTGGGGTTCTACTCCGACTCCTGCCCGGAC
GCCGAGGACACGGTCACCGCCGCCGTCCAGGACGCCGCCAACAACGACCCCACCATCCTCCCCGCGCTGCTCCGCCTCCAGTTCCACGACTGCTTCGTCAAG
GGGTGCGACGCGTCGGTG
CTGATCAGGAGCGCAAGCAACGACGCCGAGGTGGACAACAGCAAGAACCAGGGCCTGCGCGGCCAGGACGTGGTCGACGCCGCCAAGGCGCAGCTCGAGGACCAGTGCCCCGGCGTCGTC
TCCTGCGCCGACATCATCGCCCTCGCCGCACGCGACGCCGTCGCCCTG
ACGGGCGGGCCGACGTTCGACGTGCCAACGGGGCGGCGCGACGGCCTGACTTCCAACCTCCGCGACGCCGAC
GTGCTGCCGGACGCCGCCGACTCCATCAACGTGCTCCGCTCAAGCTTCGCCGCCGCCGGCCTCAACGACCGAGATCTCGTCCTCCTCACAG
CGGCGCACACGGTGGGCACGACGGCGTGC
TTCTTCGTGAAGGACCGGCTGTACAGCTTCCCTCTCCCGGGCGGCAAGGCGGGGTCGGACCCGTCGATCCCGGCGGCGTTCGTGGCGGAGCTCAAGGCCCGGTGCCCGCCGGGGGACTTC
AACACGCGGCTGCCGCTGGACCGCGGCAGCGAGAGCGACTTCGACGACTCCATCCTCCGCAACATCCGGTCGGGGCTCGCCGTCATCGCCTCCGACGCCGCGCTCGCCAACAGCAACGCC
ACCCGCGCGCTCGTCGACGCGTACCTGGGCCCCGCGGCGGGGAGCTTCGAGCGGGACTTCGCCGCCGCCATGGTCAGGATGGGCAGCATCGGCGCCATCACCGGCGACGATGACGGCGAG
ATCAGGGACGTCTGCTCCGCATTCAACACCAAC

Retrieve as FASTA