Entry information : SiPrx54 (Si010606m)
Entry ID 9550
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx54 (Si010606m)
Name (synonym) SiPrx54 (Si010606m)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx54
start..stop
S start..stop
SiPrx112 611 0 1..321 1..321
SiPrx111 580 0 10..321 18..331
SbPrx144 577 0 20..321 19..320
SbPrx83 576 0 21..321 31..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35564487..35564702 216 N° 2 35564191..35564382 192 N° 3 35563940..35564105 166 N° 4 35562796..35563184 389
complement(join(35562796..35563184,35563940..35564105,35564191..35564382,3556448 7..35564702))


exon

Literature and cross-references SiPrx54 (Si010606m)
DNA ref. Phytozome 12:   scaffold_7 (35564702..35562796)
Protein sequence: SiPrx54 (Si010606m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   33643.71 (31248.4)  
PI (pH):   %s   7.93 (7.70) Peptide Signal:   %s   cut: 26 range:26-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAARCSGGGIAPVLLLLALAGTSSAQLSTGFYSSSCPGVSSAVKSVVQSAIDKEKRMGASIVRLFFHDCFVQGCDASLLLDDTPSFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWNVKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGLARCTNFRAHVYNETNIDGAFARTRQSGCPSTSGTGDNNLAPLDLQTPTVFENNYYRNLVSKKGLLHSDQELFNGGATDAQVQSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRKNCRRMN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAAGATGCAGCGGCGGCGGCATCGCTCCCGTACTGTTGCTCCTGGCGCTGGCCGGCACCTCGTCAGCGCAGCTGTCCACCGGCTTCTACTCCAGCTCCTGCCCCGGCGTGTCC
AGCGCCGTCAAGTCCGTGGTGCAGTCCGCCATCGACAAGGAGAAGCGCATGGGCGCCTCCATCGTTCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GTACTTAGCTTCTACTGATATGCA
TGATCAATTAGTACTGATCACTCGAACTTACTTACTTACTAGCTGATCAACTTGATGACCTACAATTAACTGCGTGTCAGGGTTGCGACGCGTCGCTGCTGCTGGATGACACGCCCAGCT
TCCAGGGTGAGAAGATGGCGACGCCAAACAACGGCTCCGTGAGAGGCTTCGAGGTCATCGATGCCATCAAGTCCGCCGTCGAGAAGGTCTGCCCCGGCGTCGTCTCCTGCGCCGACATCC
TCGCCATCGCGGCGAGGGACAGCGTCGTCATC
GTAAGTGTCAAGCTGATGATGAACTTGATTGGCCGCAGTAACAACATGCATGTCGCAACTCCATCTCAACTGATCGCACATGCAGCTT
GGCGGGCCGAACTGGAACGTCAAGGTTGGGAGGAGGGACTCGACGACGGCAAGCTTCAGTGGAGCCAACAACAACATCCCACCGCCGACGTCGGGCCTCGCCAACCTGACATCCCTCTTC
GCCGCGCAGGGACTCTCCCAAAAGGACATGGTCGCGCTCTCTG
GTACGTCACGTCGTCAGGCTAAACTCTTGCACAAATTCCTACTTAGACATGTTCAAACTTCAACTATGGATGGCATC
TTTTTGGATATCAACTGTAGAATTAATGAGAAAATAAAGAAAACTCCACACTTTGCTAGCTTCTCAACAAAGGTAGCTTTAGAGATTAGATAAAGACAGCTGGTGCACACCATCGCCAAC
GGAATCGATAGCTCAGTTTTGACTTTAACCGTCGTCATATACTTGTATATCTTTAACCGTGAGTCCGTGACACAGGATCATTTACCTGGCCTGTTGATGAAGCTCAGTTAATTGTCGGTT
ACTAACATATAACACGTCTAGCACGAGATATAGTTGGTATAGATATGGACGGAATGACATGATAAAGTTTGCAAAAGGTGACAACGATGCCACAAAATGCTGTCGGTATGGGTTTCATCT
GGAAGAAAAAAGAAAGTTGTGTGTACAAGCTTATGCTTTTTGCATGTTATAAACCTGTCAACAACCACCAGTTTGCCACAAATTATATTGTTCCTTTTTTTTTGTCGCTTCATAACTAGA
ATCGAATACTCTTTTCTCTCTTATATATTTACAGAAGCAACAACCACAAGTTTCAAAAAAATGTTATAAACTTGTAATATATGATTATTATGTATAGCGAGCAATTTATTATTATGTACT
AGCTAGATTAATATGATAACCTACTTGGAATAATTAATCTTGATCGGCCTCTTGCATTGCTATGATCTGAATTGGCAGGTGCTCACACCATAGGCCTAGCACGCTGCACCAACTTCAGAG
CCCACGTATACAATGAAACCAACATCGATGGCGCCTTTGCAAGGACTAGGCAATCAGGCTGCCCTAGCACCTCAGGTACAGGTGACAACAACTTGGCACCTCTGGACCTTCAAACCCCGA
CCGTCTTTGAGAACAACTACTACCGGAACCTTGTTAGCAAGAAGGGACTTCTGCACTCTGATCAGGAGCTCTTCAACGGTGGAGCCACCGACGCGCAGGTCCAATCGTATGTTAGTAGCC
AAAGCGCATTCTTCGCCGATTTTGTGACAGGCATGATCAAGATGGGTGACATTACACCTTTGACGGGCTCCAACGGGGAGATTAGGAAGAACTGCAGGAGGATGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAAGATGCAGCGGCGGCGGCATCGCTCCCGTACTGTTGCTCCTGGCGCTGGCCGGCACCTCGTCAGCGCAGCTGTCCACCGGCTTCTACTCCAGCTCCTGCCCCGGCGTGTCC
AGCGCCGTCAAGTCCGTGGTGCAGTCCGCCATCGACAAGGAGAAGCGCATGGGCGCCTCCATCGTTCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GGTTGCGACGCGTCGCTGCTGCTG
GATGACACGCCCAGCTTCCAGGGTGAGAAGATGGCGACGCCAAACAACGGCTCCGTGAGAGGCTTCGAGGTCATCGATGCCATCAAGTCCGCCGTCGAGAAGGTCTGCCCCGGCGTCGTC
TCCTGCGCCGACATCCTCGCCATCGCGGCGAGGGACAGCGTCGTCATC
CTTGGCGGGCCGAACTGGAACGTCAAGGTTGGGAGGAGGGACTCGACGACGGCAAGCTTCAGTGGAGCCAAC
AACAACATCCCACCGCCGACGTCGGGCCTCGCCAACCTGACATCCCTCTTCGCCGCGCAGGGACTCTCCCAAAAGGACATGGTCGCGCTCTCTG
GTGCTCACACCATAGGCCTAGCACGC
TGCACCAACTTCAGAGCCCACGTATACAATGAAACCAACATCGATGGCGCCTTTGCAAGGACTAGGCAATCAGGCTGCCCTAGCACCTCAGGTACAGGTGACAACAACTTGGCACCTCTG
GACCTTCAAACCCCGACCGTCTTTGAGAACAACTACTACCGGAACCTTGTTAGCAAGAAGGGACTTCTGCACTCTGATCAGGAGCTCTTCAACGGTGGAGCCACCGACGCGCAGGTCCAA
TCGTATGTTAGTAGCCAAAGCGCATTCTTCGCCGATTTTGTGACAGGCATGATCAAGATGGGTGACATTACACCTTTGACGGGCTCCAACGGGGAGATTAGGAAGAACTGCAGGAGGATG
AAT

Retrieve as FASTA