Entry information : SiPrx59 (Si011925m)
Entry ID 9554
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-07 (Qiang Li)
Peroxidase information: SiPrx59 (Si011925m)
Name (synonym) SiPrx59 (Si011925m)
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx59
start..stop
S start..stop
SiPrx111 531 0 1..265 67..331
SbPrx83 523 0 1..265 67..331
SiPrx54 514 0 1..265 57..321
SiPrx112 509 0 1..265 57..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35556755..35556802 48 N° 2 35556889..35557080 192 N° 3 35557177..35557342 166 N° 4 35557516..35557904 389
join(35556755..35556802,35556889..35557080,35557177..35557342,35557516..35557904 )


exon

Literature and cross-references SiPrx59 (Si011925m)
DNA ref. Phytozome 12:   scaffold_7 (35556755..35557904)
Protein sequence: SiPrx59 (Si011925m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   265 (245)
PWM (Da):   %s   28009.86 (25754.8)  
PI (pH):   %s   7.34 (7.79) Peptide Signal:   %s   cut: 21 range:21-265
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASILRLFFHDFFVQGCDASLLLDDTASFQGEKMATPNNGSVRGFEVIDAIKSAVEKVCPGVVSCADILAIAARDSVVILGGPNWDVKVGRRDSTTASFSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTSFRAHVYNDTNIDGGFARTKQSACPRTSGSGDNNLAPLDLQTPTVFENNYYKNLVCKKGLLHSDQELSNGGSTDAQVRSYVSSQSAFFADFVTGMIKMGDITPLTGSNGEIRKNCRRI

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from phytozome (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCTCCATCCTCCGACTCTTCTTCCACGACTTCTTCGTCCAGGTACTTAAGATTTTTCACCAGACAGTACGATTGCTGGTGGGTGATCCACAAGCACACTCTTATTGTACATGT
GATCGATCCTGTAGGGCTGCGACGCGTCGCTGCTGCTGGATGACACTGCCAGCTTCCAGGGCGAGAAGATGGCGACGCCCAACAACGGCTCCGTCAGAGGCTTCGAGGTCATCGACGCCA
TCAAGTCCGCCGTCGAGAAGGTCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCAGCGAGGGACAGCGTCGTCATC
GTAAGTCCGTCCCCCCTGTTCCTTCTTTGACGTA
CTCATCACTCTGAAAAAAAAAGAAAATGAAACTGAACCTAGCTGCAACGACGATGGGTGCACCTGGGCGGGCCCAACTGGGACGTCAAGGTTGGGAGGAGGGACTCCACCACGGCGAGCT
TCAGCGGCGCCAACAACAACATCCCGCCGCCGACGTCGGGCCTCGCCAACCTGACCTCCCTCTTCGCCGCGCAGGGACTCTCCCAGAAGGACATGGTGGCGCTCTCCG
GTTTGTAATTCG
ATTCCCTACTCCATGCATGCATTTTCACCAAACAAAATTCAAAATTAGATCATTATTCTATCACACAACAACAAACTATGACGGGATTTCATTCTATCACACAAAATTCAAAATTAGAGC
ATTCTAATTCAGAATTCAAAATTAGAGCATTCTTTTGCCAGGAGCCCATACCATTGGCCAAGCACGCTGCACCAGCTTCAGAGCCCACGTCTACAACGACACCAACATCGATGGCGGCTT
TGCAAGAACGAAGCAATCAGCATGTCCTCGAACCTCAGGTTCAGGTGACAACAATCTGGCTCCTCTGGACCTTCAAACCCCAACCGTATTTGAGAACAACTACTACAAGAATCTTGTCTG
CAAGAAGGGGCTTCTGCACTCTGACCAGGAGCTCTCCAACGGTGGATCCACCGATGCACAGGTCCGATCGTACGTTAGTAGCCAGAGCGCATTTTTCGCTGATTTCGTGACGGGCATGAT
CAAGATGGGTGACATCACACCACTGACGGGCTCCAACGGGGAGATCAGGAAGAACTGCAGGAGGATTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCTCCATCCTCCGACTCTTCTTCCACGACTTCTTCGTCCAGGGCTGCGACGCGTCGCTGCTGCTGGATGACACTGCCAGCTTCCAGGGCGAGAAGATGGCGACGCCCAACAAC
GGCTCCGTCAGAGGCTTCGAGGTCATCGACGCCATCAAGTCCGCCGTCGAGAAGGTCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCAGCGAGGGACAGCGTCGTCATC
CTGGGCGGGCCCAACTGGGACGTCAAGGTTGGGAGGAGGGACTCCACCACGGCGAGCTTCAGCGGCGCCAACAACAACATCCCGCCGCCGACGTCGGGCCTCGCCAACCTGACCTCCCTC
TTCGCCGCGCAGGGACTCTCCCAGAAGGACATGGTGGCGCTCTCCG
GAGCCCATACCATTGGCCAAGCACGCTGCACCAGCTTCAGAGCCCACGTCTACAACGACACCAACATCGATGGC
GGCTTTGCAAGAACGAAGCAATCAGCATGTCCTCGAACCTCAGGTTCAGGTGACAACAATCTGGCTCCTCTGGACCTTCAAACCCCAACCGTATTTGAGAACAACTACTACAAGAATCTT
GTCTGCAAGAAGGGGCTTCTGCACTCTGACCAGGAGCTCTCCAACGGTGGATCCACCGATGCACAGGTCCGATCGTACGTTAGTAGCCAGAGCGCATTTTTCGCTGATTTCGTGACGGGC
ATGATCAAGATGGGTGACATCACACCACTGACGGGCTCCAACGGGGAGATCAGGAAGAACTGCAGGAGGATTAAC

Retrieve as FASTA