Entry information : SiPrx64 (Si014043m)
Entry ID 9557
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx64 (Si014043m)
Name (synonym) SiPrx64 (Si014043m)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx64
start..stop
S start..stop
SbPrx104 493 3e-177 1..333 1..336
ZmPrx80 489 1e-175 1..333 1..337
OsPrx119 451 1e-160 1..333 1..333
BdiPrx111 442 2e-157 1..333 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33848372..33848605 234 N° 2 33846751..33846942 192 N° 3 33846069..33846644 576  
complement(join(33846069..33846644,33846751..33846942,33848372..33848605))


exon

Literature and cross-references SiPrx64 (Si014043m)
DNA ref. Phytozome 11:   scaffold_6 (33848605..33846069)
Protein sequence: SiPrx64 (Si014043m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (305)
PWM (Da):   %s   36576.28 (33290.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.85 (6.25) Peptide Signal:   %s   cut: 30 range:30-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERRRRSVPLLVAAVFLAVAAMPAYPGEAATPLREDYYRYSCPNLESIVRAEVARKINETVVTIPATLRQVFHDCMAGGCDAAVLIASKKNDAQKDADDNESLAGDGFDTVNRVKTAVEKECPGKVSCADIMHLAARDVVFLAKGPYWHVELGRRDGLVSRKSDVAGKLPDPDMHVKDLSSMFESKGFSPVDLVALSGAHTVGFSHCTRFLNRLYGYSSSAPTDPSFNPEYADQLKQACPRNVGETIAVNMDPVSPITFDNKYYSNLQYGLGLFTSDQVLYTDDSTKPIVNKFAADQKAFFDAFGLAMVKLGRLGVKTGTDGEIRRVCTAFNHY

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGGCGACGGAGAAGCGTCCCCTTACTAGTGGCGGCGGTGTTCTTGGCGGTGGCCGCAATGCCGGCGTACCCCGGCGAGGCCGCGACGCCGCTGCGGGAGGACTACTACAGGTAC
AGCTGCCCGAACCTGGAGAGCATCGTGCGGGCGGAGGTGGCCAGGAAGATCAACGAGACGGTGGTCACCATCCCGGCGACGCTCCGGCAAGTCTTCCACGACTGCATGGCTGGG
GTGAGT
AGCTAGCACACAGCCGCCTCATCGCATCCTGATTGGAACTTGGCCCTCCTCTTCGCTTTGCTTTCGCCGCACTCATCATTCTCTTCCTGCTTTGATGATTTCATCCTTGCTTCGAGATGC
GCAATGCATATAGGGGTGCATTTTGATCTGCTGATTTGATTTATCAATTTTTTTGGGGGGTTCGTTTGGGGTTCCGCTCTGACCAATCTCATCCTCTTCAGTCTTCTCTGTCAACCAACT
TGCGCCACAACCGCCCCGCCCCATCTCTTTTCTTCAAGAAGCCATCTTTGCCTCTTTGGAACCACAAAGCTGCAAGTTGCAAGCTCCTTTCTCAGTCAGATAACATGGGGGCTGTCCCTG
CACTCAGTGCACTGCATCATCATCATCTTGCTGCCCAGTTCATTGCAGTCTCTGTGCTCCTGTTCTTTCTTCTTCTAGTTCTGAGAAGAAAAAAGAAAGCAGATAGGAAAGAACTCGGTT
TCTTCAGATGTTGCCAATAGAAAACTGGATTCCATTTCGCTAAAAGCTAGCTGGGTTGGTTGTTTAGTGGGGGGGAGCTGGCTGGGCTGGCTCCGGGGAACAACTCGATTGCCCCGCGTG
GTCGTCGGTTGCGGCAGCCGGGCAGGGCCTCGCATGTGCCAACGCGACTTTTCATCAGGCCCCGACGATTATCAAATTGCCGCCGTGTCGGAGGGCCTCGATGCCTTCTCGTCAGAGATC
ACAAGCCCCCGACGTGAATCCCGAGCGGCTAGCTAACTCTGCCTGAAACTGAAAATGAGGACGGCCATCTGTTTCTGAAGTTTGGAATTCATAGAGCTGTAGGTGCTTATGATTTTTTTT
GGAAATGATTTCAGTCATGCTCATCTCAAAATAAAAAAATATGACCACTAACCAGCAATTTGTTTGCAGCTGGTTTGAAAAGTTTTCTTTTTTGGAAGTTTTTGGAAGGGTAGGCAGGAC
TGACTGCTCCCATCCTTGTATTGCTACAGCTGGTTCCATGTTGCCAAGAATATGATGATTGATGAAGATGCCTCTGCTGTGTGCCTTGTGTTGTTTAGTGGCGTCCTGGCAATCAAGCAG
CTGGCATCTCGTTCCAGTCTTTTTCTCTTTTCTGGGTTGACCTACGCATTGGGATGCTGCGTGAGCTCACGTCGAGCACCAGTTGTATAGGACCCCACGCGCACGAGTAACCACAAATAT
TTTCGTATTCAAATTTTTTTCAAAAACTTCTATGTAAATATAATTTCTCCAATCTCAAATGTATGCCGTTTTGAACATCACCTAGGTTTTCAAAACAAAAATTGAGGCACCAGATATACT
GATGACATTGACACATCCTTTTGATTTCTTTCTGTTGCATTTTCATAGTTAAGTTAAACAAATTTACTGCGACTAACTCTGTCGCTCACTTGAACCGCAACAGGGTTGTGACGCCGCCGT
GCTGATAGCGTCCAAGAAAAACGATGCCCAGAAGGACGCCGACGACAACGAGTCCCTCGCCGGCGATGGCTTCGACACGGTCAACCGGGTCAAGACCGCCGTCGAGAAGGAGTGCCCCGG
CAAGGTCTCCTGCGCCGACATCATGCATCTTGCCGCCAGAGACGTCGTCTTCCTG
GTAAACCACCACGCCACCCGCCTTCAGCAAAACCAATCCCCTTTCGTTTCACTTCACTGTCCTCG
GCTTCTGACTCCCTGGCGCTCACCACCTTCAACTGTCACAGGCCAAAGGCCCCTACTGGCACGTCGAGCTCGGCCGCCGCGACGGCCTCGTCTCCAGGAAGAGCGACGTCGCCGGCAAGC
TGCCCGACCCGGACATGCACGTCAAGGATCTCTCGTCGATGTTCGAGAGCAAAGGCTTCTCCCCGGTCGACCTGGTCGCGCTCTCGGGCGCGCACACCGTCGGCTTCTCGCACTGCACCC
GCTTCCTCAACCGGCTCTACGGGTACAGCAGCAGCGCGCCGACGGACCCCTCCTTCAACCCCGAATACGCGGATCAGCTCAAGCAGGCGTGCCCGCGCAACGTCGGCGAGACCATCGCCG
TCAACATGGACCCCGTGAGCCCCATCACCTTTGACAACAAGTACTACTCCAACCTCCAGTACGGACTGGGGCTCTTCACATCCGACCAGGTGCTCTACACCGATGACTCGACCAAGCCGA
TCGTGAACAAGTTCGCTGCGGACCAGAAGGCGTTCTTTGACGCCTTTGGCCTTGCCATGGTCAAGCTCGGGAGGTTAGGGGTGAAGACCGGAACTGATGGAGAGATCAGAAGAGTCTGCA
CCGCCTTCAACCACTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGGCGACGGAGAAGCGTCCCCTTACTAGTGGCGGCGGTGTTCTTGGCGGTGGCCGCAATGCCGGCGTACCCCGGCGAGGCCGCGACGCCGCTGCGGGAGGACTACTACAGGTAC
AGCTGCCCGAACCTGGAGAGCATCGTGCGGGCGGAGGTGGCCAGGAAGATCAACGAGACGGTGGTCACCATCCCGGCGACGCTCCGGCAAGTCTTCCACGACTGCATGGCTGGG
GGTTGT
GACGCCGCCGTGCTGATAGCGTCCAAGAAAAACGATGCCCAGAAGGACGCCGACGACAACGAGTCCCTCGCCGGCGATGGCTTCGACACGGTCAACCGGGTCAAGACCGCCGTCGAGAAG
GAGTGCCCCGGCAAGGTCTCCTGCGCCGACATCATGCATCTTGCCGCCAGAGACGTCGTCTTCCTG
GCCAAAGGCCCCTACTGGCACGTCGAGCTCGGCCGCCGCGACGGCCTCGTCTCC
AGGAAGAGCGACGTCGCCGGCAAGCTGCCCGACCCGGACATGCACGTCAAGGATCTCTCGTCGATGTTCGAGAGCAAAGGCTTCTCCCCGGTCGACCTGGTCGCGCTCTCGGGCGCGCAC
ACCGTCGGCTTCTCGCACTGCACCCGCTTCCTCAACCGGCTCTACGGGTACAGCAGCAGCGCGCCGACGGACCCCTCCTTCAACCCCGAATACGCGGATCAGCTCAAGCAGGCGTGCCCG
CGCAACGTCGGCGAGACCATCGCCGTCAACATGGACCCCGTGAGCCCCATCACCTTTGACAACAAGTACTACTCCAACCTCCAGTACGGACTGGGGCTCTTCACATCCGACCAGGTGCTC
TACACCGATGACTCGACCAAGCCGATCGTGAACAAGTTCGCTGCGGACCAGAAGGCGTTCTTTGACGCCTTTGGCCTTGCCATGGTCAAGCTCGGGAGGTTAGGGGTGAAGACCGGAACT
GATGGAGAGATCAGAAGAGTCTGCACCGCCTTCAACCACTAC

Retrieve as FASTA