Entry information : SiPrx65 (Si014105m)
Entry ID 9558
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx65 (Si014105m)
Name (synonym) SiPrx65 (Si014105m)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx65
start..stop
S start..stop
SbPrx102 479 2e-172 22..319 22..319
ZmPrx15 471 6e-169 25..319 28..322
BdiPrx104 464 2e-166 1..319 1..320
OsPrx117 454 1e-162 5..318 1..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8053015..8053236 222 N° 2 8052195..8052929 735  
complement(join(8052195..8052929,8053015..8053236))


exon

Literature and cross-references SiPrx65 (Si014105m)
DNA ref. Phytozome 12:   scaffold_6 (8053236..8052195)
Protein sequence: SiPrx65 (Si014105m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (292)
PWM (Da):   %s   34684.22 (31850.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   5.2 (4.82) Peptide Signal:   %s   cut: 28 range:28-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAQMKSFVRLLILVQVAAILAGHGAAELSMDYYGMSCPYAEYIVRNVVGQALMKDPTLAGSILRLHFHDCFVQGCDASVLLDSTDDNTAEKDAPANKSLRGFEVIDSIKEALEEQCPGVVSCADVLALAARDAVFMARGPYYGVPLGRRDGSRSVASDTFLTLPPPIKNVTVLIQIFDKVGLDVHDMVALSGGHTLGIAHCANFKNRIKDETETLDATLASSLGSVCKGGDSGKAPFDRTSTRFDAVYYRELTSKRGLLSSDQTLFESPETKEMVSMFAMNPDYFFYAFQQGMLKMGQINLKEGDDGEIRHTCRVVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCCAGATGAAGAGCTTTGTCAGGCTCCTGATCCTCGTGCAGGTGGCCGCCATCCTCGCCGGGCACGGCGCCGCCGAGCTCAGCATGGACTACTACGGCATGAGCTGCCCGTAC
GCGGAGTACATCGTCCGCAACGTCGTCGGCCAGGCTCTCATGAAGGACCCCACCCTCGCCGGCAGCATCCTCAGGCTCCACTTCCACGACTGCTTCGTGCAG
GTGGTGGATTGTTACGAT
CGATCCTCTCTTCTCCTTCATGCACTTGACCACACGCACGCACACTGACACTGACACGTACGTGCAGGGCTGCGACGCGTCGGTGCTACTGGACTCGACGGACGACAACACGGCGGAGAA
GGACGCGCCGGCGAACAAGAGCCTGCGCGGCTTCGAGGTGATCGACAGCATCAAGGAGGCCCTGGAGGAGCAGTGCCCCGGCGTCGTCTCCTGCGCCGACGTCCTGGCGCTCGCCGCCCG
CGACGCTGTGTTCATGGCGCGCGGGCCCTACTACGGCGTGCCCCTGGGCCGCCGCGACGGTTCCCGCTCCGTCGCCTCCGACACCTTCCTGACGCTGCCGCCGCCGATCAAGAACGTCAC
GGTGCTCATCCAAATCTTCGACAAGGTCGGCCTCGACGTCCACGACATGGTGGCGCTCTCCGGCGGCCACACGCTGGGCATCGCGCACTGCGCCAACTTCAAGAACCGGATCAAGGACGA
GACGGAGACGCTGGACGCGACGCTGGCCTCGTCGCTGGGCTCCGTCTGCAAGGGCGGCGACTCCGGCAAGGCGCCGTTCGACCGGACCAGCACGCGCTTCGACGCCGTCTACTACCGGGA
GCTCACCTCGAAGCGGGGGCTCCTGAGCTCCGACCAGACGCTGTTCGAGTCGCCCGAGACCAAGGAGATGGTCAGCATGTTCGCCATGAACCCGGACTACTTCTTCTACGCGTTCCAGCA
GGGGATGCTCAAGATGGGGCAGATCAACCTCAAGGAAGGCGACGACGGCGAGATCAGGCACACCTGCAGGGTCGTCAACTCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCCAGATGAAGAGCTTTGTCAGGCTCCTGATCCTCGTGCAGGTGGCCGCCATCCTCGCCGGGCACGGCGCCGCCGAGCTCAGCATGGACTACTACGGCATGAGCTGCCCGTAC
GCGGAGTACATCGTCCGCAACGTCGTCGGCCAGGCTCTCATGAAGGACCCCACCCTCGCCGGCAGCATCCTCAGGCTCCACTTCCACGACTGCTTCGTGCAG
GGCTGCGACGCGTCGGTG
CTACTGGACTCGACGGACGACAACACGGCGGAGAAGGACGCGCCGGCGAACAAGAGCCTGCGCGGCTTCGAGGTGATCGACAGCATCAAGGAGGCCCTGGAGGAGCAGTGCCCCGGCGTC
GTCTCCTGCGCCGACGTCCTGGCGCTCGCCGCCCGCGACGCTGTGTTCATGGCGCGCGGGCCCTACTACGGCGTGCCCCTGGGCCGCCGCGACGGTTCCCGCTCCGTCGCCTCCGACACC
TTCCTGACGCTGCCGCCGCCGATCAAGAACGTCACGGTGCTCATCCAAATCTTCGACAAGGTCGGCCTCGACGTCCACGACATGGTGGCGCTCTCCGGCGGCCACACGCTGGGCATCGCG
CACTGCGCCAACTTCAAGAACCGGATCAAGGACGAGACGGAGACGCTGGACGCGACGCTGGCCTCGTCGCTGGGCTCCGTCTGCAAGGGCGGCGACTCCGGCAAGGCGCCGTTCGACCGG
ACCAGCACGCGCTTCGACGCCGTCTACTACCGGGAGCTCACCTCGAAGCGGGGGCTCCTGAGCTCCGACCAGACGCTGTTCGAGTCGCCCGAGACCAAGGAGATGGTCAGCATGTTCGCC
ATGAACCCGGACTACTTCTTCTACGCGTTCCAGCAGGGGATGCTCAAGATGGGGCAGATCAACCTCAAGGAAGGCGACGACGGCGAGATCAGGCACACCTGCAGGGTCGTCAACTCC

Retrieve as FASTA