Entry information : SiPrx76 (Si017780m)
Entry ID 9567
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx76 (Si017780m)
Name (synonym) SiPrx76 (Si017780m)
Class Class III peroxidase    [Orthogroup: Prx115]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx76
start..stop
S start..stop
SofPrx08 534 0 22..325 22..324
ZmPrx37 519 0 15..325 12..321
SbPrx71 506 0 1..325 1..325
BdiPrx96 491 5e-177 26..325 24..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2037403..2037627 225 N° 2 2037769..2037960 192 N° 3 2038482..2039039 558  
join(2037403..2037627,2037769..2037960,2038482..2039039)


exon

Literature and cross-references SiPrx76 (Si017780m)
DNA ref. Phytozome 12:   scaffold_1 (2037403..2039039)
Protein sequence: SiPrx76 (Si017780m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (297)
PWM (Da):   %s   33573.82 (30896.3) Transmb domain:   %s   i13-35o
PI (pH):   %s   8.32 (7.98) Peptide Signal:   %s   cut: 29 range:29-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAALLSSRRAVAAAVACVLALALGAAAQLSPTFYDGSCPNLQSIVRSAMAAAVQQEPRMGASILRLFFHDCFVQGCDASVLLDDSPTLTGEKNAAPNANSLRGYEVIDSIKSQVEAACPGTVSCADILALAARDGVNLLSGPTWAVPLGRRDTRTASQASANSNLPSPSSSAATLVSAFASKGLDSRDLVALSGAHTVGSARCSSFRSRVYNDTNINSGFAAKRRQICAAQSGGTDGNLAPLDALSPVRFDNGYFRNVVGQFGLLHSDQELFGAGGPVDGITTQYARNGAAFARDFITAMIKMGNISPLTGSSGEIRANCRKPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCGTTGCTATCCTCGAGGCGGGCGGTGGCGGCGGCCGTGGCGTGCGTGCTGGCACTGGCGCTCGGCGCCGCGGCGCAGCTGTCGCCGACGTTCTACGACGGGAGCTGCCCG
AACCTGCAGTCCATCGTGCGCTCCGCGATGGCCGCCGCCGTGCAGCAGGAGCCCCGGATGGGGGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GTACGCACCTAGCTC
CCATTCAATTCGCACGGTTGCACGCAGCTAGCTGCCGCGCCTCCCTCGGCATCAACATTTGAATGCGCGCGCGGCCGCTAGCTGGAGTGACGCTGACGTCGATGCTTGCCGGCGCGGCGC
GTGCAGGGTTGCGACGCGTCGGTGCTGCTTGACGACTCGCCGACGCTGACGGGGGAGAAGAACGCGGCGCCCAACGCCAACTCCCTCCGCGGCTACGAGGTCATCGACTCCATCAAGTCC
CAGGTCGAGGCCGCCTGCCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGGCGTCAACCTG
GTCAGTACTCAGTAGTAGTGTTACCTTCCCTCTTCATTCTCC
TTCTCCCATGCCTCTACTGGAGTATAGCAGTGGTCTCGTACACCACCTGCCGACACCCATACCACATGCTGCCACCAATCAGGCAATCACCATGCACGCCCATCAAAGTTCATCGATCTC
GTTCACCATGCATGCACTCGACTCGGCTAGCTCGAATGGTCCCGTCAAACATGCTCCGGGTGACGTGGGGGCCAGGCAGAGCCAGCCTTCACCAACCGCCTACTAGGCACGACGGATGCT
TCCTGATCTGAGCGAGCCCGTTTTGTCGCCAATGCCCACTGAGCATGTGCCCACTGTTCGTCCTGCGCCCCAGTCACAGTAGCAACAACTTGCAGTCCATGGCACTCGAGGATCCAATGC
ATGGCAAATGCCAATGAAAAAACAACAACAATAGAGTAGTAGTTGTTGTGCAAGAGAGCATAATTTAGTCAGTTCGTTTGAATTTGGTTTCACTCTGATATACTGAATAAATGGTGCAGC
TGAGCGGTCCGACGTGGGCGGTGCCGCTGGGCCGTCGCGACACGCGGACGGCGAGCCAGGCGTCGGCGAACAGCAACCTCCCATCCCCGTCCTCTTCCGCGGCCACCCTCGTCTCGGCGT
TCGCGTCCAAGGGCCTGGACTCGCGCGACCTGGTGGCGCTCTCCGGCGCGCACACCGTGGGTTCCGCGCGGTGCTCGAGCTTCCGGTCGCGCGTGTACAACGACACCAACATCAACTCCG
GGTTCGCGGCGAAGCGGCGGCAGATCTGCGCGGCCCAGAGCGGCGGCACCGACGGGAACCTCGCCCCGCTCGACGCGCTCAGCCCCGTCCGCTTCGACAACGGCTACTTCCGCAACGTCG
TCGGCCAGTTCGGCCTCCTCCACTCCGACCAGGAGCTCTTCGGCGCCGGCGGCCCCGTCGACGGCATCACGACGCAGTACGCGCGCAACGGCGCGGCGTTCGCGCGGGACTTCATCACCG
CCATGATCAAGATGGGAAACATCAGCCCGCTCACCGGGTCCAGCGGCGAGATCCGCGCCAACTGCCGGAAGCCCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGGCGTTGCTATCCTCGAGGCGGGCGGTGGCGGCGGCCGTGGCGTGCGTGCTGGCACTGGCGCTCGGCGCCGCGGCGCAGCTGTCGCCGACGTTCTACGACGGGAGCTGCCCG
AACCTGCAGTCCATCGTGCGCTCCGCGATGGCCGCCGCCGTGCAGCAGGAGCCCCGGATGGGGGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GGTTGCGACGCGTCG
GTGCTGCTTGACGACTCGCCGACGCTGACGGGGGAGAAGAACGCGGCGCCCAACGCCAACTCCCTCCGCGGCTACGAGGTCATCGACTCCATCAAGTCCCAGGTCGAGGCCGCCTGCCCC
GGCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGGCGTCAACCTG
CTGAGCGGTCCGACGTGGGCGGTGCCGCTGGGCCGTCGCGACACGCGGACGGCGAGCCAGGCG
TCGGCGAACAGCAACCTCCCATCCCCGTCCTCTTCCGCGGCCACCCTCGTCTCGGCGTTCGCGTCCAAGGGCCTGGACTCGCGCGACCTGGTGGCGCTCTCCGGCGCGCACACCGTGGGT
TCCGCGCGGTGCTCGAGCTTCCGGTCGCGCGTGTACAACGACACCAACATCAACTCCGGGTTCGCGGCGAAGCGGCGGCAGATCTGCGCGGCCCAGAGCGGCGGCACCGACGGGAACCTC
GCCCCGCTCGACGCGCTCAGCCCCGTCCGCTTCGACAACGGCTACTTCCGCAACGTCGTCGGCCAGTTCGGCCTCCTCCACTCCGACCAGGAGCTCTTCGGCGCCGGCGGCCCCGTCGAC
GGCATCACGACGCAGTACGCGCGCAACGGCGCGGCGTTCGCGCGGGACTTCATCACCGCCATGATCAAGATGGGAAACATCAGCCCGCTCACCGGGTCCAGCGGCGAGATCCGCGCCAAC
TGCCGGAAGCCCAAC

Retrieve as FASTA