Entry information : SiPrx78 ( Si017813m)
Entry ID 9569
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: SiPrx78 ( Si017813m)
Name (synonym) SiPrx78 ( Si017813m)
Class Class III peroxidase    [Orthogroup: Prx129]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx78
start..stop
S start..stop
BdiPrx97 509 0 8..320 7..324
SbPrx72 497 2e-179 27..320 26..321
ZmPrx67 496 7e-179 25..320 25..320
ZmPrx36 493 9e-178 25..320 25..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2001957..2002169 213 N° 2 2001673..2001867 195 N° 3 2001016..2001567 552  
complement(join(2001016..2001567,2001673..2001867,2001957..2002169))


exon

Literature and cross-references SiPrx78 ( Si017813m)
DNA ref. Phytozome 12:   scaffold_1 (2002169..2001016)
Protein sequence: SiPrx78 ( Si017813m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (296)
PWM (Da):   %s   32688.21 (30266.8)  
PI (pH):   %s   5.05 (4.86) Peptide Signal:   %s   cut: 25 range:25-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATRLLLLMAAALVLLVARGSDAQLSAGFYSASCPSVHGVVRQVMSQAVMNNSRSGAAILRLFFHDCFVNGCDASLLLDDTPTTPGEKGAGANAGGSTFGFDLIDDIKTQVEAACPATVSCADILALAARDSVNLLGGPSWAVPLGRRDATSPNATGAATDLPGPDSSLDRLVAAFAAKGLTSRDLAALSGAHTVGMARCLSFRTRVYCDDNVSPAFASQGRQLCPASGGDATAAPLDASTPAEFDNGYYRNLVAGAGLLHSDQELFNNGPLDSLVRLYSANGAAFSSDFAASMVRLGNVSPLTGSAGEIRIDCRKVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGACGCGGCTGCTCCTCCTGATGGCGGCGGCGCTCGTCCTCCTGGTGGCGCGCGGCTCCGACGCGCAGCTCTCGGCGGGGTTCTACTCGGCGAGCTGCCCCAGCGTGCACGGC
GTCGTGCGCCAGGTCATGTCGCAGGCCGTCATGAACAACTCGCGCAGCGGCGCCGCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GTGAGTATAGCAAAAATCGTTCTGCAT
TTGAAATCTGATTTGGGCCACGTTCGGTATGTGATTAATCGCACTGCAAATTAAATGCGCAGGGCTGCGACGCCTCGCTGCTGCTGGATGACACCCCCACGACACCCGGCGAGAAGGGCG
CCGGCGCCAACGCCGGCGGCTCCACCTTCGGCTTCGACCTCATCGACGACATCAAGACGCAGGTCGAGGCCGCGTGCCCGGCCACCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCGC
GCGACAGCGTCAACCTG
GTCAGTCCGTCTGCATTGTTCCTCTCTCTTCCCATCCCCTACTCTCACATTTTTTAGCAAAGCGACGCCACGCCATGCCTCACTCCATGTAACAACGCGACGC
AGCTCGGCGGCCCGAGCTGGGCGGTGCCGCTCGGCCGCCGCGACGCGACGTCCCCGAACGCCACGGGCGCCGCGACGGACCTCCCGGGCCCGGACTCCTCCCTCGACCGCCTCGTCGCCG
CCTTCGCCGCCAAGGGCCTCACCTCCCGCGACCTCGCCGCGCTCTCGGGCGCGCACACGGTGGGCATGGCGCGGTGCCTCAGCTTCCGCACCCGCGTCTACTGCGACGACAACGTCAGCC
CCGCCTTCGCCTCGCAGGGGCGGCAGCTCTGCCCGGCATCCGGCGGGGATGCCACCGCCGCGCCGCTCGACGCGTCCACCCCAGCCGAGTTCGACAACGGCTACTACCGGAACCTTGTCG
CCGGCGCCGGGCTGCTGCACTCCGACCAGGAGCTCTTCAACAACGGGCCGCTCGACTCGCTCGTGCGGCTCTACAGCGCCAACGGCGCCGCATTCTCGTCGGACTTCGCCGCGTCCATGG
TCAGGCTCGGGAACGTCAGCCCGCTCACGGGCTCCGCGGGGGAGATCAGGATCGACTGCAGGAAAGTGAATTCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGACGCGGCTGCTCCTCCTGATGGCGGCGGCGCTCGTCCTCCTGGTGGCGCGCGGCTCCGACGCGCAGCTCTCGGCGGGGTTCTACTCGGCGAGCTGCCCCAGCGTGCACGGC
GTCGTGCGCCAGGTCATGTCGCAGGCCGTCATGAACAACTCGCGCAGCGGCGCCGCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAC
GGCTGCGACGCCTCGCTGCTGCTGGAT
GACACCCCCACGACACCCGGCGAGAAGGGCGCCGGCGCCAACGCCGGCGGCTCCACCTTCGGCTTCGACCTCATCGACGACATCAAGACGCAGGTCGAGGCCGCGTGCCCGGCCACCGTC
TCCTGCGCCGACATCCTCGCCCTCGCCGCGCGCGACAGCGTCAACCTG
CTCGGCGGCCCGAGCTGGGCGGTGCCGCTCGGCCGCCGCGACGCGACGTCCCCGAACGCCACGGGCGCCGCG
ACGGACCTCCCGGGCCCGGACTCCTCCCTCGACCGCCTCGTCGCCGCCTTCGCCGCCAAGGGCCTCACCTCCCGCGACCTCGCCGCGCTCTCGGGCGCGCACACGGTGGGCATGGCGCGG
TGCCTCAGCTTCCGCACCCGCGTCTACTGCGACGACAACGTCAGCCCCGCCTTCGCCTCGCAGGGGCGGCAGCTCTGCCCGGCATCCGGCGGGGATGCCACCGCCGCGCCGCTCGACGCG
TCCACCCCAGCCGAGTTCGACAACGGCTACTACCGGAACCTTGTCGCCGGCGCCGGGCTGCTGCACTCCGACCAGGAGCTCTTCAACAACGGGCCGCTCGACTCGCTCGTGCGGCTCTAC
AGCGCCAACGGCGCCGCATTCTCGTCGGACTTCGCCGCGTCCATGGTCAGGCTCGGGAACGTCAGCCCGCTCACGGGCTCCGCGGGGGAGATCAGGATCGACTGCAGGAAAGTGAATTCA

Retrieve as FASTA