Entry information : SiPrx80 (Si019256m)
Entry ID 9571
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx80 (Si019256m)
Name (synonym) SiPrx80 (Si019256m)
Class Class III peroxidase    [Orthogroup: Prx220]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx80
start..stop
S start..stop
ZmPrx116 515 0 1..320 1..322
SbPrx77 491 4e-177 2..320 3..323
SiPrx82 451 4e-161 2..320 3..321
SiPrx77 445 5e-159 2..320 3..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1959239..1959448 210 N° 2 1958942..1959136 195 N° 3 1958280..1958834 555  
complement(join(1958280..1958834,1958942..1959136,1959239..1959448))


exon

Literature and cross-references SiPrx80 (Si019256m)
DNA ref. Phytozome 12:   scaffold_1 (1959448..1958280)
Protein sequence: SiPrx80 (Si019256m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (297)
PWM (Da):   %s   33969.81 (31476.6)  
PI (pH):   %s   6.49 (5.71) Peptide Signal:   %s   cut: 24 range:24-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSTTGHCLFLVLLLRSSAAYGQLSTSFYDTSCPSLQSIVRSVVSNAIAADRRMGASLVRLFFHDCFVQGCDASILLDDVPGTFVGEKTAFPNANSVRGYDVINNVKAAVEANCTGVVSCADIVALAARDGTVLLNGPTWNVSLGRRDSMTASRDQANSDLPSPFASLSTLIAAFSSKGLSAQDMTALSGAHTVGFAQCQVYRDRIYKDNNINQQFAKLRQSDCPATQGINDTVLAPLDVATQLTFDNAYYGDLLKNKGLLHSDQELYNGGSQDALVKKYGSNSAAFFADYVTAMVKMGNINPLTGTAGQIRANCAVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTCCACGACCGGGCATTGCCTGTTCCTCGTCCTTCTTCTTCGCTCCTCCGCTGCCTACGGCCAGCTCTCGACGTCGTTCTACGACACGAGCTGCCCGTCACTGCAGTCCATC
GTGCGCTCCGTCGTGTCTAACGCCATCGCCGCCGACCGCCGCATGGGCGCCTCCCTTGTCCGGCTCTTCTTCCACGACTGCTTCGTTCAG
GTATTGACGAGTCCCATATATATGCAAGCA
GTATTCTCCCCAGATTATAATACCGTCATGGAACGATCGATGAATTGGTGTGACATTTGGTACGCTGTGCAGGGCTGCGACGCCTCGATTCTTCTCGACGACGTGCCGGGGACCTTCGTC
GGCGAGAAAACCGCCTTCCCGAACGCCAACTCCGTTCGCGGCTACGACGTCATCAACAATGTCAAGGCCGCCGTCGAGGCCAACTGCACCGGCGTCGTCTCTTGCGCCGACATCGTCGCC
CTCGCCGCGAGGGACGGCACCGTGCTG
GTTCGTGCCCGGCGCGCCGCCGGCGAGCCACAGCCAGATCGACGCACGAAAATACTTGATTCGATTCCCTCGTCGCATGCCCCATTTACGCTC
GTTAATGATTGCAGCTCAACGGACCAACCTGGAACGTGTCCCTCGGCCGGCGCGACTCGATGACGGCGAGCCGGGACCAAGCGAACAGCGACCTCCCCTCGCCGTTCGCCAGCCTCAGCA
CGCTCATCGCGGCGTTCAGCAGCAAGGGCCTGAGCGCGCAGGACATGACGGCGCTCTCCGGCGCGCACACCGTCGGCTTCGCGCAGTGCCAGGTCTACCGCGACCGCATCTACAAGGACA
ACAACATCAACCAGCAGTTCGCTAAGCTGCGCCAGAGCGACTGCCCAGCGACGCAGGGCATCAACGACACCGTCCTGGCGCCGCTCGACGTGGCGACGCAGCTCACCTTCGACAACGCCT
ACTACGGGGACCTGCTCAAGAACAAAGGCCTGCTCCACTCCGACCAGGAGCTCTACAACGGCGGCTCGCAGGATGCGCTGGTGAAGAAGTACGGCTCCAACAGCGCCGCCTTCTTCGCCG
ACTACGTCACGGCAATGGTCAAGATGGGGAACATCAACCCGCTCACCGGAACTGCCGGTCAGATCAGAGCCAACTGTGCTGTGGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCGTCCACGACCGGGCATTGCCTGTTCCTCGTCCTTCTTCTTCGCTCCTCCGCTGCCTACGGCCAGCTCTCGACGTCGTTCTACGACACGAGCTGCCCGTCACTGCAGTCCATC
GTGCGCTCCGTCGTGTCTAACGCCATCGCCGCCGACCGCCGCATGGGCGCCTCCCTTGTCCGGCTCTTCTTCCACGACTGCTTCGTTCAG
GGCTGCGACGCCTCGATTCTTCTCGACGAC
GTGCCGGGGACCTTCGTCGGCGAGAAAACCGCCTTCCCGAACGCCAACTCCGTTCGCGGCTACGACGTCATCAACAATGTCAAGGCCGCCGTCGAGGCCAACTGCACCGGCGTCGTCTCT
TGCGCCGACATCGTCGCCCTCGCCGCGAGGGACGGCACCGTGCTG
CTCAACGGACCAACCTGGAACGTGTCCCTCGGCCGGCGCGACTCGATGACGGCGAGCCGGGACCAAGCGAACAGC
GACCTCCCCTCGCCGTTCGCCAGCCTCAGCACGCTCATCGCGGCGTTCAGCAGCAAGGGCCTGAGCGCGCAGGACATGACGGCGCTCTCCGGCGCGCACACCGTCGGCTTCGCGCAGTGC
CAGGTCTACCGCGACCGCATCTACAAGGACAACAACATCAACCAGCAGTTCGCTAAGCTGCGCCAGAGCGACTGCCCAGCGACGCAGGGCATCAACGACACCGTCCTGGCGCCGCTCGAC
GTGGCGACGCAGCTCACCTTCGACAACGCCTACTACGGGGACCTGCTCAAGAACAAAGGCCTGCTCCACTCCGACCAGGAGCTCTACAACGGCGGCTCGCAGGATGCGCTGGTGAAGAAG
TACGGCTCCAACAGCGCCGCCTTCTTCGCCGACTACGTCACGGCAATGGTCAAGATGGGGAACATCAACCCGCTCACCGGAACTGCCGGTCAGATCAGAGCCAACTGTGCTGTGGTTAAC

Retrieve as FASTA