Entry information : SiPrx81 (Si019549m)
Entry ID 9572
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx81 (Si019549m)
Name (synonym) SiPrx81 (Si019549m)
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx81
start..stop
S start..stop
ZmPrx57 615 0 1..338 1..339
ZmPrx71 605 0 1..338 10..347
SbPrx80 593 0 22..338 31..347
BdiPrx113 541 0 30..341 31..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37658026..37658085 60 N° 2 37658119..37659081 963  
join(37658026..37658085,37658119..37659081)


exon

Literature and cross-references SiPrx81 (Si019549m)
DNA ref. Phytozome 12:   scaffold_1 (37658026..37659081)
Protein sequence: SiPrx81 (Si019549m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   342 (322)
PWM (Da):   %s   36798.6 (34811.4)  
PI (pH):   %s   5.87 (5.40) Peptide Signal:   %s   cut: 20 range:20-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLSLLLLVAAALSGHAAAQVPAPVVGGPLSPEFYSQSCPRAERIIAEVMQSKQMASPTTAAGVLRVFFHDCFVSGCDASVLIASTQFDKSEHDAEINHSLPGDAFDAVVRAKLALELECPGVVSCADILALASRVLVTMTGGPRYPIALGRKDSLSSSPTAPEVELPHSNYTVDRLIQLFGAKGFTVQELVALSGAHTLGFSHCKEFADRLYNFRDKGGKPEAFDPSMNPSLAKGLQAVCKDYLKDPTIAAFNDIITPGKFDNMYFVNLERGLGLLSTDEELFTDPRTRPLVQLYAANSTVFFDDFGRAMEKLSLFGVKTGADGEVRRRCDAYNHGPMPK*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCTCTCCCTCCTCCTCCTCGTGGCCGCCGCCCTCTCCGGCCACGCGGCGGCGCAGGTGGTGCCGCCACCAGTCGTGGGCGGCCAGCAGGTGCCAGCGCCGGTGGTGGGCGGCCCG
CTGTCGCCGGAGTTCTACAGCCAGTCGTGCCCGCGCGCGGAGCGGATCATCGCGGAGGTGATGCAGTCGAAGCAGATGGCGAGCCCGACGACGGCGGCGGGCGTGCTCCGCGTCTTCTTC
CACGACTGCTTCGTGAGCGGGTGCGACGCGTCGGTGCTCATCGCGTCGACCCAGTTCGACAAGTCGGAGCACGACGCCGAGATCAACCACTCCCTCCCCGGGGACGCCTTCGACGCCGTG
GTCCGCGCCAAGCTGGCCCTGGAGCTCGAGTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCGCTGGCGTCGCGCGTGCTCGTCACCATGACCGGCGGGCCCCGGTACCCCATCGCC
CTGGGCCGCAAGGACTCGCTGTCGTCGTCGCCCACGGCGCCCGAAGTCGAGCTCCCGCACTCCAACTACACCGTCGATCGCCTGATCCAGCTCTTCGGCGCCAAGGGGTTCACGGTGCAG
GAGCTCGTGGCGCTCTCCGGCGCCCACACGCTGGGCTTCTCCCACTGCAAGGAGTTCGCCGACAGGCTCTACAACTTCCGGGACAAGGGCGGCAAGCCGGAGGCCTTCGACCCGAGCATG
AACCCATCCCTGGCCAAGGGGCTCCAGGCCGTGTGCAAGGACTACCTCAAGGACCCCACCATCGCGGCGTTCAACGACATCATTACGCCCGGCAAGTTCGACAACATGTACTTCGTCAAC
CTCGAGCGCGGCCTCGGCCTGCTCAGCACCGACGAGGAGCTCTTCACGGACCCGCGCACCAGGCCGCTCGTGCAGCTCTACGCCGCCAACTCCACCGTATTCTTCGACGACTTCGGCCGC
GCCATGGAGAAGCTCAGCCTCTTCGGTGTCAAGACCGGCGCCGACGGCGAGGTCAGGCGGCGCTGCGACGCCTACAACCACGGGCCCATGCCCAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCTCTCCCTCCTCCTCCTCGTGGCCGCCGCCCTCTCCGGCCACGCGGCGGCGCAGGTGCCAGCGCCGGTGGTGGGCGGCCCGCTGTCGCCGGAGTTCTACAGCCAGTCGTGCCCG
CGCGCGGAGCGGATCATCGCGGAGGTGATGCAGTCGAAGCAGATGGCGAGCCCGACGACGGCGGCGGGCGTGCTCCGCGTCTTCTTCCACGACTGCTTCGTGAGCGGGTGCGACGCGTCG
GTGCTCATCGCGTCGACCCAGTTCGACAAGTCGGAGCACGACGCCGAGATCAACCACTCCCTCCCCGGGGACGCCTTCGACGCCGTGGTCCGCGCCAAGCTGGCCCTGGAGCTCGAGTGC
CCCGGCGTCGTCTCCTGCGCCGACATCCTCGCGCTGGCGTCGCGCGTGCTCGTCACCATGACCGGCGGGCCCCGGTACCCCATCGCCCTGGGCCGCAAGGACTCGCTGTCGTCGTCGCCC
ACGGCGCCCGAAGTCGAGCTCCCGCACTCCAACTACACCGTCGATCGCCTGATCCAGCTCTTCGGCGCCAAGGGGTTCACGGTGCAGGAGCTCGTGGCGCTCTCCGGCGCCCACACGCTG
GGCTTCTCCCACTGCAAGGAGTTCGCCGACAGGCTCTACAACTTCCGGGACAAGGGCGGCAAGCCGGAGGCCTTCGACCCGAGCATGAACCCATCCCTGGCCAAGGGGCTCCAGGCCGTG
TGCAAGGACTACCTCAAGGACCCCACCATCGCGGCGTTCAACGACATCATTACGCCCGGCAAGTTCGACAACATGTACTTCGTCAACCTCGAGCGCGGCCTCGGCCTGCTCAGCACCGAC
GAGGAGCTCTTCACGGACCCGCGCACCAGGCCGCTCGTGCAGCTCTACGCCGCCAACTCCACCGTATTCTTCGACGACTTCGGCCGCGCCATGGAGAAGCTCAGCCTCTTCGGTGTCAAG
ACCGGCGCCGACGGCGAGGTCAGGCGGCGCTGCGACGCCTACAACCACGGGCCCATGCCCAAG

Retrieve as FASTA