Entry information : SiPrx82 (Si019982m)
Entry ID 9573
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-10-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-12-15 (Qiang Li)
Peroxidase information: SiPrx82 (Si019982m)
Name (synonym) SiPrx82 (Si019982m)
Class Class III peroxidase     [Orthogroup: Prx018]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx82
start..stop
S start..stop
SiPrx77 476 7e-171 1..322 1..320
ZmPrx116 465 1e-166 1..321 1..322
SbPrx74 456 7e-163 11..323 15..326
SiPrx80 451 4e-161 3..321 2..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1950919..1951134 216 N° 2 1950643..1950834 192 N° 3 1949944..1950504 561  
complement(join(1949944..1950504,1950643..1950834,1950919..1951134))


exon

Literature and cross-references SiPrx82 (Si019982m)
DNA ref. Phytozome 12:   scaffold_1 (1951134..1949944)
Protein sequence: SiPrx82 (Si019982m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (301)
PWM (Da):   %s   33991.59 (31619.5)  
PI (pH):   %s   4.46 (4.40) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSTTSHFCLLVAFFPLSSAVYGQLSTSFYASSCPALEHIVRSAVAQAIATDSRMGASLLRLFFHDCFVQGCDASILLDDVGSFVGEKTAFPNVNSVRGYDVIDSIKTAVEANCPGVVSCADIVALAARDGTVLLGGPSWDVPLGRRDSTTASRTLASSDLPSPASDLATLITAFGNKGLSARDMTALSGAHTVGYAQCKNFRSHIYNDTDIDAAFAALRRGSCDYTAGPTDGNLAPLDERTELAFDNAYYADLEARRVLLRSDQELFNGGSQDSLVQDYSTDGALFFADFVAAMINLGNISPLTGNAGQIRANCSVVNSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCGTCCACTACAAGCCATTTTTGCTTACTCGTTGCCTTCTTCCCGCTCTCCTCCGCCGTATACGGACAGCTCTCGACGTCATTCTACGCCTCGAGCTGCCCGGCGCTAGAG
CACATCGTGCGCTCCGCCGTGGCTCAGGCCATTGCCACCGACAGCCGGATGGGCGCCTCCCTCCTCAGGCTCTTCTTCCACGACTGCTTCGTTCAG
GCACCCATTTTCTTCCTCTGATCG
TCCATGCACTCTATCTCATTCAGGGTGTCACGAATGATGTATCGTCGTCTGGTTATGCAGGGCTGCGACGCCTCTATTCTTCTAGACGACGTGGGCAGCTTCGTGGGCGAGAAAACCGCC
TTCCCCAACGTCAACTCGGTCCGCGGCTACGATGTCATCGACAGTATCAAGACGGCCGTCGAGGCCAACTGCCCCGGCGTCGTCTCCTGCGCCGACATCGTCGCCCTCGCCGCACGAGAC
GGCACCGTTCTG
GTACGCGGCGCCAGGCCAGACCGCTAGAGCCAGAAATTCGATGGTGGTGAGCGGCGCCGGCGATCGAGCTCGTCGCCGTCTCTCACCTGTCATCAATCCTTATCTACT
TATACATTCTCGATCTCTGTTGCATCGCAGCTCGGGGGTCCAAGCTGGGACGTGCCTCTCGGCCGGCGCGACTCGACGACGGCGAGCCGTACCCTCGCGAGCAGCGACCTCCCGTCGCCG
GCCTCCGACCTCGCCACGCTCATCACGGCGTTCGGCAACAAGGGCCTGAGCGCGCGCGACATGACGGCGCTCTCCGGCGCGCACACCGTCGGCTACGCGCAGTGCAAGAACTTCCGCAGC
CACATCTACAACGACACCGACATTGACGCGGCGTTCGCCGCGCTGCGGCGGGGCAGCTGCGACTACACGGCTGGGCCCACCGATGGCAACCTGGCGCCGCTCGATGAGCGGACGGAGCTG
GCCTTCGACAACGCCTACTACGCGGACCTGGAGGCCAGGCGCGTCCTGCTGCGCTCCGACCAGGAGCTCTTCAATGGCGGGTCGCAGGACTCGCTGGTGCAGGACTACAGCACGGACGGC
GCGCTCTTCTTCGCCGACTTCGTGGCGGCGATGATAAACTTGGGGAACATCAGCCCGCTCACCGGAAACGCCGGCCAGATCAGGGCCAACTGTAGTGTGGTCAACAGCAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTTCGTCCACTACAAGCCATTTTTGCTTACTCGTTGCCTTCTTCCCGCTCTCCTCCGCCGTATACGGACAGCTCTCGACGTCATTCTACGCCTCGAGCTGCCCGGCGCTAGAG
CACATCGTGCGCTCCGCCGTGGCTCAGGCCATTGCCACCGACAGCCGGATGGGCGCCTCCCTCCTCAGGCTCTTCTTCCACGACTGCTTCGTTCAG
GGCTGCGACGCCTCTATTCTTCTA
GACGACGTGGGCAGCTTCGTGGGCGAGAAAACCGCCTTCCCCAACGTCAACTCGGTCCGCGGCTACGATGTCATCGACAGTATCAAGACGGCCGTCGAGGCCAACTGCCCCGGCGTCGTC
TCCTGCGCCGACATCGTCGCCCTCGCCGCACGAGACGGCACCGTTCTG
CTCGGGGGTCCAAGCTGGGACGTGCCTCTCGGCCGGCGCGACTCGACGACGGCGAGCCGTACCCTCGCGAGC
AGCGACCTCCCGTCGCCGGCCTCCGACCTCGCCACGCTCATCACGGCGTTCGGCAACAAGGGCCTGAGCGCGCGCGACATGACGGCGCTCTCCGGCGCGCACACCGTCGGCTACGCGCAG
TGCAAGAACTTCCGCAGCCACATCTACAACGACACCGACATTGACGCGGCGTTCGCCGCGCTGCGGCGGGGCAGCTGCGACTACACGGCTGGGCCCACCGATGGCAACCTGGCGCCGCTC
GATGAGCGGACGGAGCTGGCCTTCGACAACGCCTACTACGCGGACCTGGAGGCCAGGCGCGTCCTGCTGCGCTCCGACCAGGAGCTCTTCAATGGCGGGTCGCAGGACTCGCTGGTGCAG
GACTACAGCACGGACGGCGCGCTCTTCTTCGCCGACTTCGTGGCGGCGATGATAAACTTGGGGAACATCAGCCCGCTCACCGGAAACGCCGGCCAGATCAGGGCCAACTGTAGTGTGGTC
AACAGCAGC

Retrieve as FASTA