Entry information : SiPrx87 ( Si020718m)
Entry ID 9578
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: SiPrx87 ( Si020718m)
Name (synonym) SiPrx87 ( Si020718m)
Class Class III peroxidase    [Orthogroup: Prx148]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx87
start..stop
S start..stop
SbPrx25 554 0 36..339 41..344
ZmPrx21 546 0 15..339 12..339
BdiPrx37 424 4e-150 39..339 29..330
OsPrx94 419 1e-147 35..339 44..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106436..106681 246 N° 2 105568..106338 771  
complement(join(105568..106338,106436..106681))


exon

Literature and cross-references SiPrx87 ( Si020718m)
DNA ref. Phytozome 12:   scaffold_11 (106681..105568)
Protein sequence: SiPrx87 ( Si020718m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (306)
PWM (Da):   %s   35763.87 (32627.1) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.43 (6.97) Peptide Signal:   %s   cut: 34 range:34-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAATVRTRSLAGGVVPVALLLLVLCTGSSSAAGQLDVGYYNKTCPAAEEIVRNETAAAVTASPDLAAALLRLHYHDCFVQGCDASVLLDSTPNNTAERDAKPNGSLRGFDVVARVKDRLEQACPGTVSCADILALMARDAVSLAKGPSWPVALGRRDGRISSAGSCGELPPLHGDVGLMVQAFAAKGLDLKDLVVLSGAHTLGKAHCSSYADRLYASAGCSTPDPALDARYADRLRMRCTSPYADDNSTTTTELDPGSSDTFDTSYYRHVARRRGLLRSDASLLDHRFTRAYVLQAASGRYDGHFYHDFAVSMAKMAAIGVLTGDQGEIRRKCNVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCGGCGACCGTCAGGACGCGCTCGCTCGCCGGCGGCGTTGTGCCGGTGGCACTACTGCTACTCGTCTTGTGTACCGGATCATCATCAGCTGCAGGGCAGCTCGATGTGGGC
TACTACAACAAGACGTGCCCGGCGGCGGAGGAGATCGTGCGCAACGAGACGGCGGCGGCCGTCACGGCGTCGCCGGACCTCGCCGCCGCGCTGCTCAGGCTGCACTACCACGACTGCTTC
GTCCAG
GTACCTACTACCTAGCTGCAGATATTTGACATTACATACATCTTCATCTTGTTACAAACTGCAACAACTCATATTCATAATCCATCCATTATTCCAGGGCTGCGACGCGTCGGT
GCTGCTGGACTCGACGCCCAACAACACGGCGGAGCGGGACGCCAAGCCCAACGGCAGCCTCCGCGGCTTCGACGTCGTGGCCCGCGTCAAGGACCGGCTCGAGCAGGCGTGCCCGGGCAC
CGTCTCCTGCGCCGACATCCTGGCCCTCATGGCCCGCGACGCCGTCTCCCTGGCGAAGGGCCCCTCGTGGCCCGTCGCCCTGGGCCGCCGCGACGGCCGCATCTCGAGCGCCGGCAGCTG
CGGCGAGCTTCCCCCGCTGCACGGCGACGTGGGCCTCATGGTCCAGGCCTTCGCCGCCAAGGGCCTCGACCTCAAGGACCTCGTCGTGCTCTCCGGCGCGCACACGCTCGGCAAGGCGCA
CTGCTCCTCCTACGCCGACCGCCTTTACGCCTCCGCCGGATGCAGCACCCCCGACCCGGCCCTCGACGCCCGCTACGCCGACAGGCTGCGGATGCGGTGCACCAGCCCCTACGCCGACGA
CAACAGCACCACCACCACGGAGCTCGACCCCGGGAGCTCCGACACCTTCGACACCAGCTACTACCGCCACGTCGCCCGCCGCCGCGGCCTGCTCCGCTCCGACGCATCACTCCTCGACCA
CCGCTTCACCAGGGCTTACGTGCTCCAGGCCGCCTCAGGCAGGTACGACGGACACTTCTACCACGACTTCGCCGTCTCCATGGCCAAGATGGCCGCCATCGGCGTGCTCACCGGAGACCA
GGGAGAGATCAGGAGAAAGTGCAACGTCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCGGCGACCGTCAGGACGCGCTCGCTCGCCGGCGGCGTTGTGCCGGTGGCACTACTGCTACTCGTCTTGTGTACCGGATCATCATCAGCTGCAGGGCAGCTCGATGTGGGC
TACTACAACAAGACGTGCCCGGCGGCGGAGGAGATCGTGCGCAACGAGACGGCGGCGGCCGTCACGGCGTCGCCGGACCTCGCCGCCGCGCTGCTCAGGCTGCACTACCACGACTGCTTC
GTCCAG
GGCTGCGACGCGTCGGTGCTGCTGGACTCGACGCCCAACAACACGGCGGAGCGGGACGCCAAGCCCAACGGCAGCCTCCGCGGCTTCGACGTCGTGGCCCGCGTCAAGGACCGG
CTCGAGCAGGCGTGCCCGGGCACCGTCTCCTGCGCCGACATCCTGGCCCTCATGGCCCGCGACGCCGTCTCCCTGGCGAAGGGCCCCTCGTGGCCCGTCGCCCTGGGCCGCCGCGACGGC
CGCATCTCGAGCGCCGGCAGCTGCGGCGAGCTTCCCCCGCTGCACGGCGACGTGGGCCTCATGGTCCAGGCCTTCGCCGCCAAGGGCCTCGACCTCAAGGACCTCGTCGTGCTCTCCGGC
GCGCACACGCTCGGCAAGGCGCACTGCTCCTCCTACGCCGACCGCCTTTACGCCTCCGCCGGATGCAGCACCCCCGACCCGGCCCTCGACGCCCGCTACGCCGACAGGCTGCGGATGCGG
TGCACCAGCCCCTACGCCGACGACAACAGCACCACCACCACGGAGCTCGACCCCGGGAGCTCCGACACCTTCGACACCAGCTACTACCGCCACGTCGCCCGCCGCCGCGGCCTGCTCCGC
TCCGACGCATCACTCCTCGACCACCGCTTCACCAGGGCTTACGTGCTCCAGGCCGCCTCAGGCAGGTACGACGGACACTTCTACCACGACTTCGCCGTCTCCATGGCCAAGATGGCCGCC
ATCGGCGTGCTCACCGGAGACCAGGGAGAGATCAGGAGAAAGTGCAACGTCGTCAAC

Retrieve as FASTA