Entry information : SiPrx88 ( Si022514m)
Entry ID 9579
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: SiPrx88 ( Si022514m)
Name (synonym) SiPrx88 ( Si022514m)
Class Class III peroxidase    [Orthogroup: Prx060]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx88
start..stop
S start..stop
ZmPrx24 568 0 28..350 26..357
SbPrx97 551 0 9..349 15..361
ZmPrx58 550 0 24..350 22..351
SofPrx14 540 0 3..350 6..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 248842..249093 252 N° 2 249179..249976 798  
join(248842..249093,249179..249976)


exon

Literature and cross-references SiPrx88 ( Si022514m)
DNA ref. Phytozome 12:   scaffold_3 (248842..249976)
Protein sequence: SiPrx88 ( Si022514m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   350 (329)
PWM (Da):   %s   37122.78 (35091.7) Transmb domain:   %s   i9-31o
PI (pH):   %s   6.16 (5.90) Peptide Signal:   %s   cut: 22 range:22-350
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSSRVAVLLLAISSAALCAVLSSATVTVNEPIVDGLSWSFYDASCPSVEGIVRWHVTEALRRDIGIAAGLIRIFFHDCFPQGCDASVLLSGSNSEQLEIPNVTLRPAALKLIDDIRSALHHACGPKVSCADITTLATRDAVVASGGPYFDVPLGRRDGLAPASSNLVGTLPAPSFDVPTLIEAFKNRSLDTADLVALSGAHTVGLSHCNSFSDRLPPTADDTMDPAFREKLTAKCAKDPNGTVVTQVLDVRTPDAFDNKYYFDLIAKQGLFKSDQGLIDHPATKRMATRFSLNQGAFFDQFARSMVKMSQMDVLTGNKGEIRLNCAVRNARASGLQTAADEGLAADA

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCTCCAGCAGCAGAGTGGCCGTCCTCCTCCTTGCCATCTCATCTGCAGCCCTGTGCGCCGTCCTTTCGTCGGCCACCGTGACCGTGAACGAGCCCATCGTGGACGGCCTCTCG
TGGAGCTTCTACGACGCGTCGTGCCCCTCGGTGGAGGGCATCGTGCGGTGGCACGTCACGGAGGCGCTCCGGCGCGACATCGGCATCGCCGCCGGACTCATCCGCATCTTCTTCCACGAC
TGCTTCCCGCAG
GTTGGTTTCAGTTAGCAGGTTCGTGATCGACAGATGGCGGCCATCGTCTGACATACTTACGTGGACTAACATCAACTATCAACAGGGTTGCGACGCTTCCGTGCTCCT
GTCGGGTTCCAACAGCGAGCAGCTTGAGATCCCCAACGTGACGCTGCGCCCCGCGGCGCTGAAGCTCATCGACGACATCCGCTCCGCCCTCCACCACGCGTGCGGCCCCAAGGTGTCGTG
CGCCGACATCACCACGCTCGCCACCAGGGACGCCGTCGTCGCGTCCGGAGGTCCCTACTTCGACGTCCCCCTCGGGCGCCGCGACGGCCTCGCGCCGGCGTCGAGCAACCTCGTCGGAAC
CCTGCCGGCCCCCTCCTTCGACGTGCCGACGCTGATCGAGGCGTTCAAGAACCGCAGCCTGGACACGGCGGACCTGGTGGCGCTGTCCGGCGCGCACACCGTGGGGCTCAGCCACTGCAA
CTCCTTCAGCGACCGGCTGCCGCCCACCGCCGACGACACCATGGACCCGGCCTTCAGGGAGAAGCTGACGGCCAAGTGCGCCAAGGACCCCAACGGGACGGTGGTGACGCAGGTGCTGGA
CGTGCGGACGCCCGACGCCTTCGACAACAAGTACTACTTCGACCTGATCGCGAAGCAGGGGCTCTTCAAGTCGGACCAGGGCCTCATCGACCACCCGGCCACCAAGCGCATGGCCACCCG
CTTCTCCCTCAACCAGGGCGCCTTCTTCGACCAGTTCGCAAGGTCCATGGTGAAGATGAGCCAGATGGACGTGCTCACCGGCAACAAGGGAGAGATCCGCCTCAACTGCGCCGTGCGCAA
CGCCAGGGCATCAGGACTCCAGACCGCCGCCGACGAGGGGCTCGCCGCGGACGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGCTCCAGCAGCAGAGTGGCCGTCCTCCTCCTTGCCATCTCATCTGCAGCCCTGTGCGCCGTCCTTTCGTCGGCCACCGTGACCGTGAACGAGCCCATCGTGGACGGCCTCTCG
TGGAGCTTCTACGACGCGTCGTGCCCCTCGGTGGAGGGCATCGTGCGGTGGCACGTCACGGAGGCGCTCCGGCGCGACATCGGCATCGCCGCCGGACTCATCCGCATCTTCTTCCACGAC
TGCTTCCCGCAG
GGTTGCGACGCTTCCGTGCTCCTGTCGGGTTCCAACAGCGAGCAGCTTGAGATCCCCAACGTGACGCTGCGCCCCGCGGCGCTGAAGCTCATCGACGACATCCGCTCC
GCCCTCCACCACGCGTGCGGCCCCAAGGTGTCGTGCGCCGACATCACCACGCTCGCCACCAGGGACGCCGTCGTCGCGTCCGGAGGTCCCTACTTCGACGTCCCCCTCGGGCGCCGCGAC
GGCCTCGCGCCGGCGTCGAGCAACCTCGTCGGAACCCTGCCGGCCCCCTCCTTCGACGTGCCGACGCTGATCGAGGCGTTCAAGAACCGCAGCCTGGACACGGCGGACCTGGTGGCGCTG
TCCGGCGCGCACACCGTGGGGCTCAGCCACTGCAACTCCTTCAGCGACCGGCTGCCGCCCACCGCCGACGACACCATGGACCCGGCCTTCAGGGAGAAGCTGACGGCCAAGTGCGCCAAG
GACCCCAACGGGACGGTGGTGACGCAGGTGCTGGACGTGCGGACGCCCGACGCCTTCGACAACAAGTACTACTTCGACCTGATCGCGAAGCAGGGGCTCTTCAAGTCGGACCAGGGCCTC
ATCGACCACCCGGCCACCAAGCGCATGGCCACCCGCTTCTCCCTCAACCAGGGCGCCTTCTTCGACCAGTTCGCAAGGTCCATGGTGAAGATGAGCCAGATGGACGTGCTCACCGGCAAC
AAGGGAGAGATCCGCCTCAACTGCGCCGTGCGCAACGCCAGGGCATCAGGACTCCAGACCGCCGCCGACGAGGGGCTCGCCGCGGACGCC

Retrieve as FASTA