Entry information : SiPrx94 (Si022620m)
Entry ID 9585
Creation 2011-07-03 (Qiang Li)
Last sequence changes 2011-12-07 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-08 (Christophe Dunand)
Peroxidase information: SiPrx94 (Si022620m)
Name (synonym) SiPrx94 (Si022620m)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Setaria
Organism Setaria italica    [TaxId: 4555 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SiPrx94
start..stop
S start..stop
SbPrx96 611 0 12..333 17..337
ZmPrx04 605 0 3..333 4..332
OsPrx58 604 0 5..333 9..337
BdiPrx134 581 0 7..333 18..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1374522..1374752 231 N° 2 1374237..1374434 198 N° 3 1372818..1372983 166 N° 4 1370381..1370784 404
complement(join(1370381..1370784,1372818..1372983,1374237..1374434,1374522..1374 752))


exon

Literature and cross-references SiPrx94 (Si022620m)
DNA ref. Phytozome 12:   scaffold_3 (1374752..1370381)
Protein sequence: SiPrx94 (Si022620m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   333 (303)
PWM (Da):   %s   35461.13 (32729.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.09 (8.73) Peptide Signal:   %s   cut: 31 range:31-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAGGLLLRGAAALTVAVLMLGIAGAARAQLRQNYYASSCPSAESTVRSVISQRLQQSFAVGPGTLRLFFHDCFVRGCDASVMLMAPNGDDESHSGADATLSPDAVDAINKAKAAVEALPGCAGKVSCADILAMAARDVVSLLGGPNYAVELGRLDGKSFNRAIVKHVLPGPGFNLDQLNSLFAQNGLTQTDMIALSGAHTIGVTHCDKFIRRIYTFKQHLPWNPPMNLEYLRSLRRVCPINYSPTAIAMLDASTPRVFDNAYFNNLRYNKGLLASDQVLFTDRRSRPTVNLFAANNTAFQEAFVAAMAKLGRIGLKTGSDGEVRRVCTAV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCCGGCGGCCTCCTGCTGCGCGGCGCGGCGGCGCTCACGGTCGCCGTCCTGATGCTGGGCATTGCTGGCGCCGCGAGGGCGCAGCTGCGGCAGAACTACTACGCCAGCTCC
TGCCCCAGCGCGGAGTCCACGGTGCGCTCCGTCATCTCGCAGCGCCTCCAGCAGAGCTTCGCCGTCGGGCCCGGCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCCGG
GTAAAGAAA
GCTGCCGCCGCCTCGTGATCTCGCCGTGCATTGCCGTTGCCTCTGCTCCGCTAACGGCCTTGCTGCATGTTCGTGAAGGGATGCGACGCGTCGGTGATGCTGATGGCGCCGAACGGGGAC
GACGAGAGCCATAGCGGCGCGGACGCGACACTGTCGCCAGACGCCGTGGACGCCATCAACAAGGCCAAGGCGGCCGTGGAGGCGCTCCCCGGGTGCGCCGGCAAGGTGTCGTGCGCGGAC
ATCCTCGCCATGGCCGCACGTGACGTCGTCTCCCTG
GTAACCGAACGCGCCTCCTCTCTTGCTCACCCACCAATCGTCCCATTCCGCCCGTTTTCACCGCAGTGTTGCTATCTCAATCTT
CCCGTGCACGTACCACGGCCATACCACCGGTCGCCCGGCCTGTCGCCGACTCGCCGCAGGGCACACCGTTGTTGTCAGCGGCCAGCGCGCACGGAGCCCACACCAAAGCTTCCGCCTTGC
TGGTCGGTTCAGAGTTCAGACGTTCAGTTCACCCTCCCGTTGCACACTTTNNNNNNNNNNNNNNNNNNNNNNNNCCCCAGTTAGGTTAGGTCGCCATGGCCCGCCACACCGGCACTGTTC
CAAGCCTGGGTGTCAGTGACTTTTTGGCCGGCCGCAGCCTGCCAGCCGGGCCTGCACAGCGCGGCGCACCACCCCGATTCGGCCCCCGCGGCGCCCAGAGCGGGGCATGTGCTTCGTGTC
AGCCGCTGGCCCGCGGCCGGATGCCCCCGGACGGGCGGGCACGGGCACTTCGCGTCGCCGAGGCCAAGCCACCCACTTCGGGTCCGTACTTTGTTGTTGGTCGTTGGTGCTCGCGGCGCG
GCGGGCTCGGGCAACGACGCCCGGTGCCGTTGGGGAGCGTACGGTGGCGAGAGGTAGCATGCGCAGGCAGGATGGCCGGGGCGCCGGGCCTTTCGCCCCTTTCGAGACGACGGGCAACAG
CTTCGACCTGCTACGGCCTACGGAGGACTAGCGGACGCAGCATGATGGATCGTTGCGACAGTGACGTGACATGCGTCTGACTAGTCTAGGACCCCTCGGGACACCACAGCGCTGTGCCCG
TACCACGGTACCAGTGCGTAGGATTTGTAGGCCGTGTCCTGGTGCTGCCCGTGACGCCCCGGCAGAGCGGAGTGAGCCTCGTCACCTTGGTCCGTGACGCGCGCTGGCGACGGCTGCGAC
GGCGACGCGATGCCGTCCGTTCTTGGCATGCAAGCGTCTCCTCTCGTCACGTCGCGTCTGGGAGAGGAAGACCAGCAGGGAGGGGACAAAGTTTCCACTCCGTAGACTGTAGCCATGGAA
TGCGTACAATGTTAGCTTACAAACTACTACTACTCTACAGCAAAAGGAGCCAATTCGACAGTGCTGACCAATCTACCAGACTAGCTAGTTCGACCAAGAACTGATGTCACTACAGTAAAA
TGAGGAAATTTACCCTGCAATGCTAACATTTTAACACCGTGGATCTCTGTTACTGTCTTTATTCAAAAAAAGAATCTCTATTGCTGCAGCTGGGCGGGCCAAACTACGCCGTTGAGCTCG
GGCGGCTGGACGGCAAGTCCTTCAACAGGGCCATCGTCAAGCACGTTCTCCCCGGCCCGGGCTTCAACCTGGACCAGCTCAACTCCCTGTTCGCGCAGAACGGGCTCACGCAGACGGACA
TGATCGCGCTCTCAG
GTGCGTGTGCTCTTCCTCTATTGTTTTTCTCTCTACAAACACGTCAACACTCAACTATATGGTGACATCTAAACTCATGCCATCGCAAAATGAAATGCAGCACGG
TGCAAACTGTTTTCACCGTGGGTATTAACAATAATGCTTCATCGTTGCCATCGGGTGAGCGAATCTTGAGGTCACAATCTGGGTTGCAAACTGTTTTAACCGTGGGTATTAACAATAATG
CTTCATCGTTATTGTTTTTTTAGTAGTATAAGTTCGTCGTTTGATCGCAGTACGAGCATCTTTCTCGTGCACTCTGTGGCTCACGTGACTTTATCCTCTGTTTGCTGCTGCACAAGACAA
AAGTGGTTCACTGTTCTATGCTACTGCCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGGTTTATCATGATTAGCATTTTGTTATGTGGGAGATGAATTCAATATGTCATCTCAT
TGTTATTCTTACTACCAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAAA
AGGAATTCCCTGCAAATAAAGGACGCCCTGATCTCCTCCCCTCATCTACTTGCTGTGTTCTTTCGTGCTAAAAATTAACTGAATAATGTGACATGATAGGCAGTATTGAATTGATCAGTA
GATCACAAAGAAAGAGACTGGCTATAGTCGCTGATCCGTGATGCAAAGAGGCAATGATGAAGAACTCACGGAGTCATGGTCTCACGGACTGACGGAGGCATCTTTGGTGAATCGATGGCG
TTCGGGCGTCAGACATCCTTGAGTCGCCGGCGGCCGTCTGTCGCGAAGACGCAAACTCACGATGTATCATGTATGCGCGACGGCGGCGTGACCGGCTGACCACCGCCCTCTCCGTGGTCC
CGAAAGACATGGCTAATGGATAGGGTTAAAATCCATTAGCTCCTCACTTATTCTTTTTATCTCTTTCCTTTTTATCTTTTCACAAGTCATTAGTACCTATTAGTTCCTTCCCGACAGCTA
ATGCTTTTCGCACATTTTGGAAGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACTTTCACCTATTAGCAGTT
GGATCCAAATAGACCTAAGAGAACCATTATCTTAGAAAAACGCAAAAAAATGCAGAGTACTTTGTGTTGCAGTAAAGTGCACATCTAGAGGTGAAAAAACCGACATGTAAAGTGATAAAG
TAATCACTCAATAACAGGCTAAACAGCCTTTCAAAAGTAACTCTGCTTCATTGTGGGAGCTTGCTACCTCGGAAAAATAATAAAGTATTCCTAAAAAGAACTTTTCTGGGATTTTTGTGT
GTTTTTATCTCTGACACTTTGGGTTACCTTGTTTAGGCGCTCACGATTTGTTTTATCATTGATTCTGTATTGGGAGGATTAATAAAAGCTATTTGTAGTACATGGGAACAGAGGACACAT
TGTCTGAATGTTCTTGGTTTCTGTCAGATCCTACTGTGGTAGTTAAACTAAACACTGCTGCTTGGATTCAGATTTGAACACACGAGGCCTTTCCCTGTGACAAAATCGAAACAAGCGGCA
GTAACTTTTGAGTGAACCACCCAATTTTGTCCATGCAAAGCACTGATTGATAGTTAAAATGGAAAAGAAAAGCTGACACTGCATACCTAGGGGACTTTGTACAGGCTTTTCACCATTATG
AAAAGATCTATCAGAAAATTCAGAACTGTATTTGCCGTGGATTCAGCCATCTACCAATTCTAAACTGAAGTTTGTTTGATCTAGGCTGTAGTAACATACTAACAAATCACGGCATCTGCA
TTATGCAGGCGCTCACACGATCGGCGTGACACACTGCGACAAGTTCATCCGCCGGATCTACACGTTCAAGCAGCACCTGCCGTGGAACCCGCCGATGAACCTGGAGTACCTGCGGTCGCT
GCGTCGGGTGTGCCCCATCAACTACAGCCCGACGGCGATCGCGATGCTGGACGCGTCCACGCCCAGGGTCTTCGACAACGCCTACTTCAACAACCTCCGCTACAACAAGGGCCTGCTCGC
CTCCGACCAGGTGCTCTTCACCGACCGCCGCTCCCGCCCCACCGTCAACCTCTTCGCCGCCAACAACACCGCCTTCCAGGAGGCGTTCGTCGCCGCCATGGCCAAGCTCGGCAGGATCGG
CCTCAAGACCGGCAGCGACGGCGAGGTGCGCCGCGTCTGCACCGCCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCCGGCGGCCTCCTGCTGCGCGGCGCGGCGGCGCTCACGGTCGCCGTCCTGATGCTGGGCATTGCTGGCGCCGCGAGGGCGCAGCTGCGGCAGAACTACTACGCCAGCTCC
TGCCCCAGCGCGGAGTCCACGGTGCGCTCCGTCATCTCGCAGCGCCTCCAGCAGAGCTTCGCCGTCGGGCCCGGCACGCTCCGCCTCTTCTTCCACGACTGCTTCGTCCGG
GGATGCGAC
GCGTCGGTGATGCTGATGGCGCCGAACGGGGACGACGAGAGCCATAGCGGCGCGGACGCGACACTGTCGCCAGACGCCGTGGACGCCATCAACAAGGCCAAGGCGGCCGTGGAGGCGCTC
CCCGGGTGCGCCGGCAAGGTGTCGTGCGCGGACATCCTCGCCATGGCCGCACGTGACGTCGTCTCCCTG
CTGGGCGGGCCAAACTACGCCGTTGAGCTCGGGCGGCTGGACGGCAAGTCC
TTCAACAGGGCCATCGTCAAGCACGTTCTCCCCGGCCCGGGCTTCAACCTGGACCAGCTCAACTCCCTGTTCGCGCAGAACGGGCTCACGCAGACGGACATGATCGCGCTCTCAG
GCGCT
CACACGATCGGCGTGACACACTGCGACAAGTTCATCCGCCGGATCTACACGTTCAAGCAGCACCTGCCGTGGAACCCGCCGATGAACCTGGAGTACCTGCGGTCGCTGCGTCGGGTGTGC
CCCATCAACTACAGCCCGACGGCGATCGCGATGCTGGACGCGTCCACGCCCAGGGTCTTCGACAACGCCTACTTCAACAACCTCCGCTACAACAAGGGCCTGCTCGCCTCCGACCAGGTG
CTCTTCACCGACCGCCGCTCCCGCCCCACCGTCAACCTCTTCGCCGCCAACAACACCGCCTTCCAGGAGGCGTTCGTCGCCGCCATGGCCAAGCTCGGCAGGATCGGCCTCAAGACCGGC
AGCGACGGCGAGGTGCGCCGCGTCTGCACCGCCGTCAAC

Retrieve as FASTA