Entry information : AtPrx15 (At2g18150 / PER15 / AtperoxP15 / AtP36)
Entry ID 96
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-06-02 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: AtPrx15 (At2g18150 / PER15 / AtperoxP15 / AtP36)
Name (synonym) AtPrx15 (At2g18150 / PER15 / AtperoxP15 / AtP36)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Rosettes
Inducers Cold stress
Drought
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx15
start..stop
S start..stop
AhalPrx05 675 0 1..338 1..339
AlyPrx15 672 0 1..338 1..339
BstrPrx49 662 0 1..338 1..337
CrubPrx71 640 0 1..338 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7893344..7893586 243 N° 2 7893057..7893248 192 N° 3 7892812..7892977 166 N° 4 7892298..7892713 416
complement(join(7892298..7892713,7892812..7892977,7893057..7893248,7893344..7893 586))


exon

Literature and cross-references AtPrx15 (At2g18150 / PER15 / AtperoxP15 / AtP36)
Protein ref. UniProtKB:   Q9SI16
DNA ref. Phytozome 11:   Chr2 (7893586..7892298)
mRNA ref. GenBank:   NM_127372
Cluster/Prediction ref. Phytozome Gene 11:   19640062 UniGene:   At.28467
Omic ref. ePlant:   At2g18150 TAIR:   At2g18150
Protein sequence: AtPrx15 (At2g18150 / PER15 / AtperoxP15 / AtP36)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   338 (316)
PWM (Da):   %s   36969.01 (34484.6)  
PI (pH):   %s   5.09 (4.96) Peptide Signal:   %s   cut: 23 range:23-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARIGSFLIILYLIYALTLCICDDDESNYGGDKGNLFPGFYRSSCPRAEEIVRSVVAKAVARETRMAASLMRLHFHDCFVQGCDGSLLLDTSGSIVTEKNSNPNSRSARGFEVVDEIKAALENECPNTVSCADALTLAARDSSVLTGGPSWMVPLGRRDSTSASLSGSNNNIPAPNNTFNTIVTRFNNQGLDLTDVVALSGSHTIGFSRCTSFRQRLYNQSGNGSPDRTLEQSYAANLRQRCPRSGGDQNLSELDINSAGRFDNSYFKNLIENMGLLNSDEVLFSSNEQSRELVKKYAEDQEEFFEQFAESMIKMGNISPLTGSSGEIRKNCRKINNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns), 6 cDNA and 11 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAAGCTAAA ATGTTTTTTT ATGCAATAAA AAACAAATCT CATGTTTTCT TAAGCTGTAT ACATTTATTA TGTCTTCAGA GCTTATATGC TTCTTTAAAG TTTTTGTTTA TTAAAAAACA  GATTTTCTTC AAAATATATT TGGTTTTAGT TTTATCTAAG AAATACAAGA AAAGAAAGAA AACAGCCTTC GGTTTGTTCT TCTCGACAGA AGATCAAGCA TTCTCCATGG CTTCAACCAT  GCGCTCATGC AGCCTCTATT TTTCCCTTTT ACTTCTTCAT CATACGAAAC ATCTTGATTG AATTTAGTTC TAGTAAATAA TGTTAAGTTT TTTTTTTCTT TTCTACTAAA TAAAAACTCA  TGATGAGGCA TAATCTATAT ACTTTGCAAG AAATGCTTTC ATATTAGTGT TTTATTCATC CATAAAAAAA CTATTTAAGT TGAAATAATA ATAAATATTA GTATCATATA GGAGTATAAC  TTATATATCA GAGAACCATT TATTAAACTT GTCTTAATTA TGTCCTTAAG ATTGTACACA TGACATGGCT CTGCAAAACA TAACTCAGTT CAAGTATCCC TTGGGATGAC ATGCGTTTTC  GGGGTTTTGT TTCTCGATCA TTAATTAGTT TCTAGAAAGA GAGACGACGT CAAGAGTCAA AACCAAATGA AAGTAGGAAC CACACACGCG TTGAAATGTT CATAGTTTTC TTCACCTTTG  ATATTCGCTT TTTACCTGCA TATCCATGTT TTATGATAGA AGACAAAAAC CCTTTTGCTT TTTTATTGTT TATAAGTCAA CAAACGAATA ACATTTTGAG GGATATTATT TGTTTTTCCT  TTTGTCAAGA GAGCAGTTAG AAACTGTTCA TACTCTTTGT CCCTTTTAGT TAATTTTTTA TCACAACAAA GGAAGACTTG TGAAACCTTG ACTACTTACT TACTAAACCA CGACCAAGTA  AAACATTGTT TTTTTTTTGT AACTATATAA AGCTTTCTTT ATAATAGTTA GGTTTAAATC TGAAGTGTCA AGAATTTTAA AAAACGCGTG CGTGCTTTGT GACCGAATCA TCATTTATGT  TTCTCTATGA TTTAATTTCA AAATGGTGCG GGTTTATAGT CTAATAGCAG TATTTGTTTA TAGATAAATA GCATTTATTT ATTTCTTTTT ACTCTAATTA AATTCTTTGG TTCTTTCTTT  CCTTTCTATT TGGTTGTGAC ATTTACATTT CATATCAATA CATTGTATCT CCCTTGTTAT TTAGCTTTCA ACTAATAAGA AAACTCTTCT TAAAGAAATC TGACTAGTTA ACGTGATCAA  TTATACGTTC TATATTGTCG ATCGGTAAGA GTTCCATATA TTCACTCGTT TCAAACAAAG TTATATATCA AAACCGGCAG TAAAACTAAA TTTTAAAACT GTCAAGATCC GAACAATCTT  ACCATTTGTT GTGTACAATA AAAACTTATG ACTGAAAATG CATGAAAATA ATCTATTAAA AACCAAATAA AAATTCAAAA TCCTAGTTTT CAAACTAAAT TGTTAACTGT TAATAGATCA  CCATTAATTC GTCACAAAGT TCACCTTAAC CTTTTAATCA CTACTTTTAA CTTTTGGTTC TATGTTGGCT CTATCAAAAT AAATTTTAGT TTTAACTTTA TAAAAATAAC TAGAAACTAG  TATAATAACC AAAAATGGCG GTGAAATAGT CAAACAATTC ATGCAAGCTT GGGACATTTG GATACCAAAC CCAAGATTTA GTCTCTTTGA TTTCAAACCA TTTTTTCAAT ACATTGTCAT  TTTTTAATAT ATCTCTTAAT TGATTAAACC CCAATCAAGT TACCAACTCT ATTGCCTTGC TTTTTCCTCT TCATGACGCT ATAATCCACG AACCCTCTGG CCTATATATA CTTTCGATTC 
TTCTTCTAAT CCTTCATATC TCCTACCATC ACAAAGTCAT CTCCTTCTTC TTTCTTGATC TAGCTAGCGG AAAATTTGAC A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCCTAGTA TCGGATGGGA GAAATAGAAA TGTGACATGT TTTGGAGGAA GGAATTTATG TTTATGTTTT TTTTTATATT GTATGAGTCT GTATTTCTTT GTGTCAAGAA TTTGAATTTT  GTAAGTTTAA ATGATTGAAA CTATCTATAA TTAAAATGTT ATTACAGTTA CGTTTGTTTA AGGCCTTATG GAAACTCTAT AGGTCATGAA AGTCGACCAG AAATAACGAG ATATGAAAAC  AAAATAAAAT AACATCATGG AAAATCTTAA AAAATGTAGT GTCTAAATAT TTGATATCCT AACTATAATC TTTTAAAATA ATTAGGTTTG AAGGAAATTG GCCGAACATA TTCTCACCTT  CTTTTTTGCA TTTTTCTTTT CTAAATATGT CGACGAAATT TTGAAAAAAA AAAATATGCA TCTCGACGAA TTCATTGTCC AGTTGTATAT GTGAGTGAAT AAGGCATATG TTTATCTATT  AGTTTTATCC TTTTCCTCTT TGAATCCTAT TATAGAAATC CAAAGTTGGT CTGTGTCTAC ACGATTTCAA TGATGACATA TAGGGGCATG CTTGCTTCTC CACATTTAGT TATTCCATGC  ATATATTATA CACGATGTGA TGTATTTTTG AAGATATTCC ATGCATCGTT CAAGTTATAA ATAATATATA TATATGACTG ATCGAGAAAA CAAAAAATCG TTTGTAATAT GTTAGCTTAA  CATAGCCATG ACTTAATCTA CTGTTTAGTA AATATGTTAA GCTTTAAAAT TTTCATAGTA GAATACTTGT GGTTGTACTT GCCTAGTAGC AAACACGATG TTTTAAACGC CAAAATTCTA 
TGTACCGTAC AAGGCATAGT TCACAGTATA TTTCTCTACA TATATTTTAA GATCTTTTGT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCGGAAGCTTTCTCATTATTCTTTACCTCATTTACGCTCTTACTCTCTGCATCTGCGACGACGACGAGAGTAACTATGGCGGCGACAAAGGGAACCTCTTCCCAGGTTTC
TACAGAAGCTCGTGCCCTAGAGCCGAGGAGATCGTGAGGTCAGTTGTAGCCAAAGCTGTTGCAAGGGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTCCACGATTGTTTCGTT
CAG
GTACTAGAGAGGTTTTTTTTAAGGAACTTGCTCAATAAGTTTAGTGTTGAGACACATCATTAATTAATTTTATCTGTTCGAATGAAAATGTGTAGGGTTGTGATGGATCGTTGCTTC
TAGACACCAGTGGGAGTATAGTTACTGAGAAGAACTCTAACCCGAACAGCAGATCGGCTCGCGGGTTTGAAGTTGTTGACGAGATCAAGGCAGCATTAGAGAACGAATGCCCTAACACTG
TTTCTTGTGCTGATGCCTTAACTCTAGCCGCTAGAGACTCCTCTGTTCTT
GTAAGTCGCTTTCTTTCTCTGTCTCTCTCTATTGCTTCTTTAAGTTCTCAACATCTAATTTGGTTCGGTT
TGTGTGTAGACTGGTGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGATTCGACAAGTGCAAGCTTGAGTGGATCAAACAACAACATTCCTGCACCCAACAACACTTTCAACACAATT
GTCACGAGATTTAACAACCAAGGTCTCGATCTCACCGACGTTGTTGCTCTCTCCG
GTAAGCTTACTTAACACACAAGGAAGAAATTTACTTGCTTCTAAAGCTAAGTTGAACCTTAATAA
CGGGTTTATCATAATTTGACCTCAATTTTTCAGGGAGCCACACCATTGGATTTTCAAGATGCACTAGTTTCAGACAGAGACTGTACAACCAATCCGGAAACGGAAGTCCCGACAGAACCT
TAGAGCAATCCTACGCTGCTAACTTGCGCCAAAGGTGCCCTAGATCGGGTGGGGACCAGAACCTGTCAGAGCTTGACATCAACAGCGCTGGAAGATTTGATAACAGCTACTTCAAGAACT
TGATCGAGAACATGGGACTGTTGAATTCCGACGAGGTCTTGTTCTCTAGCAATGAGCAATCAAGAGAGCTCGTCAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAGTTCGCGG
AGTCGATGATCAAGATGGGGAATATCTCTCCCTTGACAGGTTCGAGTGGTGAGATCAGAAAGAATTGCAGGAAAATTAATAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGAATCGGAAGCTTTCTCATTATTCTTTACCTCATTTACGCTCTTACTCTCTGCATCTGCGACGACGACGAGAGTAACTATGGCGGCGACAAAGGGAACCTCTTCCCAGGTTTC
TACAGAAGCTCGTGCCCTAGAGCCGAGGAGATCGTGAGGTCAGTTGTAGCCAAAGCTGTTGCAAGGGAGACTCGTATGGCTGCTTCTCTCATGAGGCTCCATTTCCACGATTGTTTCGTT
CAG
GGTTGTGATGGATCGTTGCTTCTAGACACCAGTGGGAGTATAGTTACTGAGAAGAACTCTAACCCGAACAGCAGATCGGCTCGCGGGTTTGAAGTTGTTGACGAGATCAAGGCAGCA
TTAGAGAACGAATGCCCTAACACTGTTTCTTGTGCTGATGCCTTAACTCTAGCCGCTAGAGACTCCTCTGTTCTT
ACTGGTGGACCAAGCTGGATGGTTCCTTTGGGAAGAAGAGATTCG
ACAAGTGCAAGCTTGAGTGGATCAAACAACAACATTCCTGCACCCAACAACACTTTCAACACAATTGTCACGAGATTTAACAACCAAGGTCTCGATCTCACCGACGTTGTTGCTCTCTCC
G
GGAGCCACACCATTGGATTTTCAAGATGCACTAGTTTCAGACAGAGACTGTACAACCAATCCGGAAACGGAAGTCCCGACAGAACCTTAGAGCAATCCTACGCTGCTAACTTGCGCCAA
AGGTGCCCTAGATCGGGTGGGGACCAGAACCTGTCAGAGCTTGACATCAACAGCGCTGGAAGATTTGATAACAGCTACTTCAAGAACTTGATCGAGAACATGGGACTGTTGAATTCCGAC
GAGGTCTTGTTCTCTAGCAATGAGCAATCAAGAGAGCTCGTCAAGAAGTATGCAGAGGATCAAGAAGAGTTCTTCGAGCAGTTCGCGGAGTCGATGATCAAGATGGGGAATATCTCTCCC
TTGACAGGTTCGAGTGGTGAGATCAGAAAGAATTGCAGGAAAATTAATAACTCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CATATCTCCT ACCATCACAA AGTCATCTCC TTCTTCTTTC TTGATCTAGC TAGCGGAAAA TTTGACAATG GCAAGAATCG GAAGCTTTCT CATTATTCTT TACCTCATTT ACGCTCTTAC  TCTCTGCATC TGCGACGACG ACGAGAGTAA CTATGGCGGC GACAAAGGGA ACCTCTTCCC AGGTTTCTAC AGAAGCTCGT GCCCTAGAGC CGAGGAGATC GTGAGGTCAG TTGTAGCCAA  AGCTGTTGCA AGGGAGACTC GTATGGCTGC TTCTCTCATG AGGCTCCATT TCCACGATTG TTTCGTTCAG GGTTGTGATG GATCGTTGCT TCTAGACACC AGTGGGAGTA TAGTTACTGA  GAAGAACTCT AACCCGAACA GCAGATCGGC TCGCGGGTTT GAAGTTGTTG ACGAGATCAA GGCAGCATTA GAGAACGAAT GCCCTAACAC TGTTTCTTGT GCTGATGCCT TAACTCTAGC  CGCTAGAGAC TCCTCTGTTC TTACTGGTGG ACCAAGCTGG ATGGTTCCTT TGGGAAGAAG AGATTCGACA AGTGCAAGCT TGAGTGGATC AAACAACAAC ATTCCTGCAC CCAACAACAC  TTTCAACACA ATTGTCACGA GATTTAACAA CCAAGGTCTC GATCTCACCG ACGTTGTTGC TCTCTCCGGG AGCCACACCA TTGGATTTTC AAGATGCACT AGTTTCAGAC AGAGACTGTA  CAACCAATCC GGAAACGGAA GTCCCGACAG AACCTTAGAG CAATCCTACG CTGCTAACTT GCGCCAAAGG TGCCCTAGAT CGGGTGGGGA CCAGAACCTG TCAGAGCTTG ACATCAACAG  CGCTGGAAGA TTTGATAACA GCTACTTCAA GAACTTGATC GAGAACATGG GACTGTTGAA TTCCGACGAG GTCTTGTTCT CTAGCAATGA GCAATCAAGA GAGCTCGTCA AGAAGTATGC  AGAGGATCAA GAAGAGTTCT TCGAGCAGTT CGCGGAGTCG ATGATCAAGA TGGGGAATAT CTCTCCCTTG ACAGGTTCGA GTGGTGAGAT CAGAAAGAAT TGCAGGAAAA TTAATAACTC  TTGATTTCCT AGTATCGGAT GGGAGAAATA GAAATGTGAC ATGTTTTGGA GGAAGGAATT TATGTTTATG TTTTTTTTTA TATTGTATGA GTCTGTATTT CTTTGTGTCA AGAATTTGAA 
TTTTGTAAGT TTAAATGATT GAAACTATCT ATAATTAAAA TGTTATTAC 

Retrieve as FASTA