Entry information : TvCIIBB[P]10 (MnP13)
Entry ID 9606
Creation 2011-10-05 (Christophe Dunand)
Last sequence changes 2011-10-05 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2012-03-27 (Catherine Mathe (Scipio))
Peroxidase information: TvCIIBB[P]10 (MnP13)
Name (synonym) TvCIIBB[P]10 (MnP13)
Class Other class II peroxidase type B     [Orthogroup: CIIBB001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB[P]10
start..stop
S start..stop
TvCIIBB10 448 4e-160 8..237 175..404
TvCIIBB09 430 1e-153 8..237 135..364
TvCIIBB06 425 1e-151 8..237 135..364
TvCIIBB06_Gangwondo 425 1e-151 8..237 135..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2258761..2258981 221 N° 2 2258226..2258705 480 N° 3 2258153..2258165 13  
complement(join(2258153..2258165,2258226..2258705,2258761..2258981))


exon

Literature and cross-references TvCIIBB[P]10 (MnP13)
DNA ref. JGI genome:   scaffold_10 (2258981..2258153)
Protein sequence: TvCIIBB[P]10 (MnP13)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   25162.65  
PI (pH):   %s   4.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFPNKGIQFAGAIGVSNCPGAPRLDVFIGRKGATQPAPDLTVPEPFDDVTKILARFEDAGRFTPAEVVALLASHTIAAADHIDPTIPGTPFDSTPELFDTQFFIETQLRGTLFPGNGSNQGEVMSPLHGELRLQSDAELARDIRTSCEWQSFVNNQAKLQSAFKAAFAKMTVLGQNTRELIDCSDVVPTPPAPASKAHFPAGLTHRDVEQACFFVPFPTLPTDPGPATSVAPVPPS

Retrieve as FASTA  
Remarks Partial or pseudogen from genomic (2 introns and large (5' end is missing => Hd is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTCCTAATAAGGGCATCCAGTTTGCAGGTGCGATCGGCGTGAGCAACTGCCCCGGCGCGCCCCGCCTGGACGTGTTCATCGGCCGCAAGGGCGCAACCCAGCCCGCGCCCGAC
CTGACGGTGCCCGAGCCGTTCGACGACGTCACCAAGATCCTGGCGCGCTTCGAAGATGCGGGCAGGTTCACCCCCGCTGAGGTCGTCGCCCTCCTGGCGTC
GTATGCCCCTTCATCTATT
TCTGATCCTCCCTCAGTACTGACTTACAATCGGCAGGCACACGATCGCCGCTGCCGACCACATCGACCCGACCATCCCGGGAACGCCTTTCGACTCCACCCCCGAGCTCTTCGACACGCA
GTTCTTCATTGAGACCCAGCTCCGCGGGACGCTCTTCCCTGGCAACGGCAGCAACCAGGGCGAAGTGATGTCGCCGCTCCACGGCGAGCTCCGTCTTCAATCCGACGCCGAGCTCGCGCG
CGACATCCGCACCTCGTGCGAGTGGCAGTCGTTCGTGAACAACCAGGCGAAGCTGCAGTCCGCGTTCAAGGCCGCGTTCGCGAAGATGACCGTGCTTGGCCAGAACACGCGCGAGCTCAT
CGACTGCTCCGACGTCGTCCCCACCCCGCCTGCGCCCGCGAGCAAGGCGCACTTCCCGGCCGGGCTCACGCACCGTGACGTCGAGCAGGCGTGCTTCTTCGTGCCCTTCCCGACGCTCCC
CACCGACCCCGGACCGGCTACTTCCGTCGCCCCCGT
GTAAGTTCCTATACTTCCGAACGGCACGCATACACTCAGCACTGACGCGTCGACTTGTAGCCCCCCGTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTTCCTAATAAGGGCATCCAGTTTGCAGGTGCGATCGGCGTGAGCAACTGCCCCGGCGCGCCCCGCCTGGACGTGTTCATCGGCCGCAAGGGCGCAACCCAGCCCGCGCCCGAC
CTGACGGTGCCCGAGCCGTTCGACGACGTCACCAAGATCCTGGCGCGCTTCGAAGATGCGGGCAGGTTCACCCCCGCTGAGGTCGTCGCCCTCCTGGCGTC
GCACACGATCGCCGCTGCC
GACCACATCGACCCGACCATCCCGGGAACGCCTTTCGACTCCACCCCCGAGCTCTTCGACACGCAGTTCTTCATTGAGACCCAGCTCCGCGGGACGCTCTTCCCTGGCAACGGCAGCAAC
CAGGGCGAAGTGATGTCGCCGCTCCACGGCGAGCTCCGTCTTCAATCCGACGCCGAGCTCGCGCGCGACATCCGCACCTCGTGCGAGTGGCAGTCGTTCGTGAACAACCAGGCGAAGCTG
CAGTCCGCGTTCAAGGCCGCGTTCGCGAAGATGACCGTGCTTGGCCAGAACACGCGCGAGCTCATCGACTGCTCCGACGTCGTCCCCACCCCGCCTGCGCCCGCGAGCAAGGCGCACTTC
CCGGCCGGGCTCACGCACCGTGACGTCGAGCAGGCGTGCTTCTTCGTGCCCTTCCCGACGCTCCCCACCGACCCCGGACCGGCTACTTCCGTCGCCCCCGT
CCCCCCGTCTTAA

Retrieve as FASTA