Entry information : TvCIIBB12 (MnP1-short)
Entry ID 9608
Creation 2011-10-13 (Christophe Dunand)
Last sequence changes 2011-10-13 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-30 (Nizar Fawal)
Peroxidase information: TvCIIBB12 (MnP1-short)
Name (synonym) TvCIIBB12 (MnP1-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Trametes
Organism Trametes versicolor (Coriolus versicolor )    [TaxId: 5325 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value TvCIIBB12
start..stop
S start..stop
TvCIIBB06 593 0 1..365 1..364
TvCIIBB06_Gangwondo 593 0 1..365 1..364
TvCIIBB09 588 0 1..365 1..364
TvCIIBB02 586 0 1..365 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2037648..2037708 61 N° 2 2037245..2037587 343 N° 3 2036986..2037186 201 N° 4 2036449..2036928 480
N° 5 2036382..2036394 13  
complement(join(2036382..2036394,2036449..2036928,2036986..2037186,2037245..2037 587,2037648..2037708))


exon

Literature and cross-references TvCIIBB12 (MnP1-short)
DNA ref. JGI genome:   scaffold_10 (2037708..2036382)
Protein sequence: TvCIIBB12 (MnP1-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (344)
PWM (Da):   %s   37770.59 (35577.4)  
PI (pH):   %s   4.02 (3.98) Peptide Signal:   %s   cut: 22 range:22-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKMLASFVSLLAALQVTNGALTRRVACPDGVNTASNAACCALFPVLEDIQKNLFDGGECGEEVHESLRLTFHDAIGISPKIAATGSFGGGGADGSIAIFDDIEPNFHANNGVDDIIEAQAPFIAAHNLTTADFIQFAGAIGVSNCPGAPRLDVFVGRKDATQPAPDGTVPEPFDSVDSILARFDDAGGFSAAEVVALLASHTIAAADHVDPTIPGTPFDSTPELFDTQFFIETQLKGTAFPGTSGNQGELESPLAGELRLQSDGLLARDSRTACEWQSFVDNQAKLQSAFKAAFKKMTILGSDINDLVDCSEVVPTPPAPASPAHFPAGLGIDDVEQACAETPFPTLPTDPGPVTSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGATGCTTGCTTCCTTTGTTTCTCTTCTCGCCGCCCTCCAGGTGACCAACGGTACGTTTCCTTCCCTCGTCCCCAGTCCACGGCCACGGTCTGACAGGATCTGTCCCATA
GGTGCTCTCACCCGCCGTGTGGCGTGCCCGGACGGTGTTAACACCGCTTCCAACGCCGCGTGCTGTGCCCTCTTCCCCGTCCTCGAGGACATCCAGAAGAACCTCTTCGACGGCGGCGAG
TGTGGCGAGGAGGTGCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATCGGCATCTCGCCCAAGATCGCCGCCACCGGCTCTTTCGGTGGTGGAGGTGCTGACGGCTCCATCGCCATC
TTCGACGACATCGAGCCTAACTTCCACGCGAACAACGGTGTCGACGACATCATCGAAGCCCAGGCGCCGTTCATCGCCGCCCACAACCTGACCACCGCCGACTT
GTACGTGTTCCCGTCC
TGATTTTCCAACTCTCCCACAATGGCTGACATGGGATTACAGCATCCAGTTCGCGGGTGCTATCGGTGTTAGCAACTGCCCTGGTGCGCCCCGCCTCGACGTCTTCGTCGGCCGCAAGGA
CGCCACCCAGCCCGCGCCCGACGGCACCGTCCCCGAGCCCTTCGACTCGGTCGACAGCATCCTCGCCCGCTTCGACGACGCCGGTGGCTTCTCTGCTGCTGAGGTCGTCGCTCTCCTCGC
CTC
GTAAGCGCCTCTCACTCCGCATGGTCAGCGCACAGGCACTGATATTGTCCTCCACAGGCACACCATCGCGGCGGCGGACCACGTCGACCCGACGATCCCGGGCACGCCGTTCGACTC
CACCCCCGAGCTCTTCGACACGCAGTTCTTCATCGAGACGCAGCTCAAGGGCACCGCCTTCCCCGGCACCTCGGGCAACCAGGGCGAGCTCGAGTCCCCGCTCGCGGGCGAGCTCCGTCT
GCAGTCCGACGGGCTCCTCGCGCGCGACTCGCGCACCGCGTGCGAGTGGCAGTCGTTCGTCGACAACCAGGCGAAGCTCCAGAGCGCGTTCAAGGCCGCGTTCAAGAAGATGACGATCCT
CGGGAGCGACATCAACGACCTCGTCGACTGCTCGGAGGTCGTGCCCACGCCGCCTGCCCCCGCCAGCCCGGCGCACTTCCCCGCGGGCCTCGGCATCGACGATGTTGAGCAGGCGTGCGC
GGAGACCCCCTTCCCCACGCTCCCCACCGACCCTGGACCCGTCACCTCCGTGGCCCCTGT
GTAAGTTCTTCCTTTCCACCGTGCCCAGCATGACACTGACGGTGTTCTTTACAGCCCCCC
CTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAGATGCTTGCTTCCTTTGTTTCTCTTCTCGCCGCCCTCCAGGTGACCAACGGTGCTCTCACCCGCCGTGTGGCGTGCCCGGACGGTGTTAACACCGCTTCCAACGCCGCG
TGCTGTGCCCTCTTCCCCGTCCTCGAGGACATCCAGAAGAACCTCTTCGACGGCGGCGAGTGTGGCGAGGAGGTGCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATCGGCATCTCG
CCCAAGATCGCCGCCACCGGCTCTTTCGGTGGTGGAGGTGCTGACGGCTCCATCGCCATCTTCGACGACATCGAGCCTAACTTCCACGCGAACAACGGTGTCGACGACATCATCGAAGCC
CAGGCGCCGTTCATCGCCGCCCACAACCTGACCACCGCCGACTT
CATCCAGTTCGCGGGTGCTATCGGTGTTAGCAACTGCCCTGGTGCGCCCCGCCTCGACGTCTTCGTCGGCCGCAAG
GACGCCACCCAGCCCGCGCCCGACGGCACCGTCCCCGAGCCCTTCGACTCGGTCGACAGCATCCTCGCCCGCTTCGACGACGCCGGTGGCTTCTCTGCTGCTGAGGTCGTCGCTCTCCTC
GCCTC
GCACACCATCGCGGCGGCGGACCACGTCGACCCGACGATCCCGGGCACGCCGTTCGACTCCACCCCCGAGCTCTTCGACACGCAGTTCTTCATCGAGACGCAGCTCAAGGGCACC
GCCTTCCCCGGCACCTCGGGCAACCAGGGCGAGCTCGAGTCCCCGCTCGCGGGCGAGCTCCGTCTGCAGTCCGACGGGCTCCTCGCGCGCGACTCGCGCACCGCGTGCGAGTGGCAGTCG
TTCGTCGACAACCAGGCGAAGCTCCAGAGCGCGTTCAAGGCCGCGTTCAAGAAGATGACGATCCTCGGGAGCGACATCAACGACCTCGTCGACTGCTCGGAGGTCGTGCCCACGCCGCCT
GCCCCCGCCAGCCCGGCGCACTTCCCCGCGGGCCTCGGCATCGACGATGTTGAGCAGGCGTGCGCGGAGACCCCCTTCCCCACGCTCCCCACCGACCCTGGACCCGTCACCTCCGTGGCC
CCTGT
CCCCCCCTCGTAA

Retrieve as FASTA