Entry information : FmeCIIBB01 (MnP2-short)
Entry ID 9612
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2017-03-09 (Catherine Mathe)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-03-09 (Catherine Mathe)
Peroxidase information: FmeCIIBB01 (MnP2-short)
Name (synonym) FmeCIIBB01 (MnP2-short)
Class Other class II peroxidase type B     [Orthogroup: CIIBB001]*
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeCIIBB01
start..stop
S start..stop
PstrCIIBB02 504 0 8..357 5..359
PcriCIIBB07 503 2e-180 8..357 5..359
PoVP04_PC15 500 2e-179 9..357 6..357
HanCIIBB07 499 4e-179 5..357 2..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1822974..1823481 508 N° 2 1822496..1822918 423 N° 3 1822305..1822434 130 N° 4 1822230..1822242 13
complement(join(1822230..1822242,1822305..1822434,1822496..1822918,1822974..1823 481))


exon

Literature and cross-references FmeCIIBB01 (MnP2-short)
DNA ref. JGI genome:   scaffold_10 (1823481..1822230)
Protein sequence: FmeCIIBB01 (MnP2-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   357 (336)
PWM (Da):   %s   37273.3 (35090.1)  
PI (pH):   %s   4.21 (4.12) Peptide Signal:   %s   cut: 22 range:22-357
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVGRSVVILSSLALSLSGVRAAITKRVNCPDGKNTASNAACCAWFPILEDIQQNLFDGGECGEEVHESLRLTFHDAIGFSPSAGGGGADGSIITFADTETKFHANGGIDDIVGTQAPFVQKHNVTPGDFIQFAGAVGVSNCPGAPRIQFFAGRPAPTAASPDQLIPEPFDSVDKILARFADAGFSTNEVVALLASHSIAAADHVDETIPGSPFDSTPGVFDSQFFIETQLKGTLFPGTSGNQGEVESPLLGEIRLQSDADLARDSRTACEWQSFVLDQDKMRSAFAAAMLKLSTVGHNLNDLVDCSEVIPDVKPNNAAPYFPGTLTTADVDQACDATPFPSLASNPAVTSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from JGI (last very short exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGAAGATCTGTCGTTATTCTTTCTTCACTCGCTCTATCCCTTTCTGGTGTGCGTGCCGCAATCACCAAGCGTGTTAACTGTCCGGATGGCAAAAACACGGCGTCGAACGCAGCA
TGTTGTGCTTGGTTCCCTATTTTGGAGGATATCCAGCAGAACCTCTTTGATGGTGGAGAGTGCGGCGAGGAGGTTCACGAATCCCTTCGCCTGACGTTCCACGACGCTATCGGTTTCTCA
CCAAGTGCTGGTGGAGGAGGTGCTGATGGTTCGATCATCACTTTCGCCGACACAGAGACGAAGTTCCATGCGAATGGTGGCATCGACGATATTGTTGGCACGCAGGCGCCATTTGTTCAG
AAGCACAACGTGACGCCTGGCGATTTCATTCAGTTCGCTGGTGCTGTCGGCGTTAGCAACTGCCCTGGCGCTCCCCGTATACAGTTCTTTGCCGGTCGTCCAGCGCCTACCGCCGCTTCT
CCAGATCAACTCATTCCTGAACCTTTCG
GTAAGTCTATCTCGTACTTTTAGTTCTGTAAATGCTTATAATTGTTCTTGACTAGACTCCGTTGACAAGATCCTTGCAAGATTTGCGGACGC
CGGGTTCAGCACGAACGAGGTTGTCGCACTCCTTGCTTCTCACTCTATTGCCGCAGCCGACCATGTCGATGAGACAATTCCGGGATCTCCGTTCGACTCTACCCCAGGTGTCTTCGACAG
CCAGTTCTTCATTGAGACACAGCTTAAAGGCACACTCTTCCCCGGTACTAGTGGAAACCAGGGCGAGGTCGAGTCACCGCTCCTAGGTGAAATCCGTCTTCAGTCCGACGCTGATCTTGC
ACGCGACTCTCGTACTGCATGCGAGTGGCAGAGCTTTGTCCTCGACCAGGACAAGATGCGTTCGGCGTTCGCAGCTGCTATGTTGAAGCTCTCTACTGTTGGCCACAACTTGAACGATCT
CGTTGACTGCTCAGAGGTCATTCCTG
GTAAGCTCGAGATTCATCCAAGACGATGATTTGAATATTGACCAAAGGATTCCGCATGCAGATGTCAAGCCGAACAATGCTGCTCCTTACTTCC
CTGGTACCCTGACCACCGCTGATGTCGACCAGGCATGTGACGCTACACCTTTCCCTTCCCTGGCCTCGAACCCTGCGGTTACTTCCGTAGCGCCTGT
GTAAGTGTCTAGCATCGCATCTA
CAGACATCTATTCAAACTAACTTTGCTTTACTCTTCCAGTCCTCCCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGAAGATCTGTCGTTATTCTTTCTTCACTCGCTCTATCCCTTTCTGGTGTGCGTGCCGCAATCACCAAGCGTGTTAACTGTCCGGATGGCAAAAACACGGCGTCGAACGCAGCA
TGTTGTGCTTGGTTCCCTATTTTGGAGGATATCCAGCAGAACCTCTTTGATGGTGGAGAGTGCGGCGAGGAGGTTCACGAATCCCTTCGCCTGACGTTCCACGACGCTATCGGTTTCTCA
CCAAGTGCTGGTGGAGGAGGTGCTGATGGTTCGATCATCACTTTCGCCGACACAGAGACGAAGTTCCATGCGAATGGTGGCATCGACGATATTGTTGGCACGCAGGCGCCATTTGTTCAG
AAGCACAACGTGACGCCTGGCGATTTCATTCAGTTCGCTGGTGCTGTCGGCGTTAGCAACTGCCCTGGCGCTCCCCGTATACAGTTCTTTGCCGGTCGTCCAGCGCCTACCGCCGCTTCT
CCAGATCAACTCATTCCTGAACCTTTCG
ACTCCGTTGACAAGATCCTTGCAAGATTTGCGGACGCCGGGTTCAGCACGAACGAGGTTGTCGCACTCCTTGCTTCTCACTCTATTGCCGCA
GCCGACCATGTCGATGAGACAATTCCGGGATCTCCGTTCGACTCTACCCCAGGTGTCTTCGACAGCCAGTTCTTCATTGAGACACAGCTTAAAGGCACACTCTTCCCCGGTACTAGTGGA
AACCAGGGCGAGGTCGAGTCACCGCTCCTAGGTGAAATCCGTCTTCAGTCCGACGCTGATCTTGCACGCGACTCTCGTACTGCATGCGAGTGGCAGAGCTTTGTCCTCGACCAGGACAAG
ATGCGTTCGGCGTTCGCAGCTGCTATGTTGAAGCTCTCTACTGTTGGCCACAACTTGAACGATCTCGTTGACTGCTCAGAGGTCATTCCTG
ATGTCAAGCCGAACAATGCTGCTCCTTAC
TTCCCTGGTACCCTGACCACCGCTGATGTCGACCAGGCATGTGACGCTACACCTTTCCCTTCCCTGGCCTCGAACCCTGCGGTTACTTCCGTAGCGCCTGT
TCCTCCCTCTTAA

Retrieve as FASTA