Entry information : FmeCIIBB02 (MnP2-short)
Entry ID 9613
Creation 2011-10-14 (Christophe Dunand)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2017-03-09 (Catherine Mathe)
Peroxidase information: FmeCIIBB02 (MnP2-short)
Name (synonym) FmeCIIBB02 (MnP2-short)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeCIIBB02
start..stop
S start..stop
BaCIIBB03 540 0 1..363 1..364
HanCIIBB02 525 0 1..363 1..356
TvCIIBB15_KN9522 522 0 1..363 1..364
HanCIIBB07 521 0 1..363 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2058431..2058491 61 N° 2 2058545..2058672 128 N° 3 2058725..2058801 77 N° 4 2058861..2059117 257
N° 5 2059175..2059492 318 N° 6 2059551..2059723 173 N° 7 2059784..2059848 65 N° 8 2059903..2059915 13
join(2058431..2058491,2058545..2058672,2058725..2058801,2058861..2059117,2059175 ..2059492,2059551..2059723,2059784..2059848,2059903..2059915)


exon

Literature and cross-references FmeCIIBB02 (MnP2-short)
DNA ref. JGI genome:   scaffold_6 (2058431..2059915)
Protein sequence: FmeCIIBB02 (MnP2-short)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (342)
PWM (Da):   %s   37694.41 (35556.3)  
PI (pH):   %s   4.12 (4.12) Peptide Signal:   %s   cut: 22 range:22-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSYLLSAITTIAALQSANAALTKRVTCPDGNVASDAACCSLFAVRDDIQQSLFDGGECGEVHESLRLTFHDAIGFSPKMTASGSFGGGGADGSIITFADTETAFHANNGVDEIIEAQQPFIAKHNMTAGDFIQFAGAVGLSNCPGAPRLEFLFGRPPAVAPSPDLLVPEPDTITSILARFGDAGFSPEEVVALLASHSVAAADHVDESIPGSPFDSTPSTFDTQVFVEVQLRGTLFPGTGGNQGEVQSPIGGEIRLQSDHDLARDSRTACIWQSFVNNQAKMQTEFRSAMAKLATLGQDTSKLVDCSDVIPVPPPFTGAAVFPPSLTNEDVEQCATSAFPTLSTLPGAATSISPVPAS

Retrieve as FASTA  
Remarks Complete sequence from genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAGCTACCTCTTGTCAGCTATCACGACCATTGCTGCACTGCAGTCAGCTAATGGTGAACGCAGCTTTTCTTTTACTCCGTCTGCCATTGCTCATGCTGTTGTCTAGCCGCTC
TGACGAAACGTGTAACCTGTCCTGATGGCAATGTAGCCTCGGATGCTGCCTGCTGTTCACTCTTTGCTGTTCGCGACGACATTCAGCAGAGCCTATTCGACGGCGGCGAATGTGGAGAGG
AG
GTATGCTCGCACCTCCTTTCTCAGAATAACAGATTGTGATTGCTACTAATAGGTCCACGAATCTTTGCGTCTCACATTCCATGATGCTATTGGATTTTCTCCGAAGATGACCGCGTCA
GGTAGCTTTGG
GTACGTACATTGACATATTCACGATTTCTCGCTTGACTGAGCCATCCCGGGTCTAACAGTGGTGGAGGAGCGGACGGTTCGATTATTACGTTCGCCGATACCGAAACGG
CATTCCATGCAAACAATGGTGTCGATGAGATTATTGAAGCGCAGCAACCATTCATTGCAAAGCACAATATGACTGCTGGTGATTTCATCCAGTTCGCTGGAGCCGTTGGCCTCAGTAACT
GCCCTGGTGCACCACGCCTGGAGTTCTTGTTCGGACGCCCCCCAGCTGTAGCACCCTCTCCGGACCTTCTTGTCCCAGAACCTTTTG
GTGAGCCCGGCGCTTAGACCAATCATTTGGGCC
TCGATTGCTAATGCCTTTTACAAGACACTATCACCAGCATCCTCGCGCGCTTTGGCGACGCAGGTTTCAGCCCGGAAGAGGTCGTTGCCCTTCTTGCTTCCCACTCGGTCGCTGCAGCCG
ACCACGTTGACGAATCGATACCGGGCTCGCCATTCGATTCGACCCCATCTACCTTTGATACTCAGGTCTTTGTTGAGGTTCAATTACGCGGGACTCTCTTCCCCGGCACGGGTGGTAACC
AAGGCGAAGTCCAATCACCCATAGGAGGAGAGATTCGCTTGCAATCTGACCACGACCTTGCCCGTGACTCACGAACAGCATGCATCTGGCAGTCCTTTGTCA
GTGAGTATAGATTTAACT
CTTAATTCTCGGTATGCACATGACATAACAATGCTCTTAGACAACCAGGCTAAGATGCAAACGGAGTTCAGGTCCGCGATGGCGAAGCTCGCTACTCTCGGCCAGGACACTTCGAAGCTG
GTTGACTGCTCTGACGTCATCCCAGTTCCTCCACCATTCACTGGCGCCGCTGTCTTCCCTCCTAGCTTGACGAACGAGGACGTTGAGCAGGCG
GTATGTACTCAGTTGAGGTCCATTAGA
AAGTAGGTACTAAACAACTTTCTTCCTAAACAGTGCGCTACGTCAGCATTCCCAACATTGTCTACACTCCCTGGTGCAGCGACATCTATCTCCCCTGTGTAAGTTCATTATTCATCTGAG
TATTAACTTCCGGCTCAACTGCTGCATTGTAGCCCTGCGTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAGCTACCTCTTGTCAGCTATCACGACCATTGCTGCACTGCAGTCAGCTAATGCCGCTCTGACGAAACGTGTAACCTGTCCTGATGGCAATGTAGCCTCGGATGCTGCCTGC
TGTTCACTCTTTGCTGTTCGCGACGACATTCAGCAGAGCCTATTCGACGGCGGCGAATGTGGAGAGGAG
GTCCACGAATCTTTGCGTCTCACATTCCATGATGCTATTGGATTTTCTCCG
AAGATGACCGCGTCAGGTAGCTTTGG
TGGTGGAGGAGCGGACGGTTCGATTATTACGTTCGCCGATACCGAAACGGCATTCCATGCAAACAATGGTGTCGATGAGATTATTGAAGCGCAG
CAACCATTCATTGCAAAGCACAATATGACTGCTGGTGATTTCATCCAGTTCGCTGGAGCCGTTGGCCTCAGTAACTGCCCTGGTGCACCACGCCTGGAGTTCTTGTTCGGACGCCCCCCA
GCTGTAGCACCCTCTCCGGACCTTCTTGTCCCAGAACCTTTTG
ACACTATCACCAGCATCCTCGCGCGCTTTGGCGACGCAGGTTTCAGCCCGGAAGAGGTCGTTGCCCTTCTTGCTTCC
CACTCGGTCGCTGCAGCCGACCACGTTGACGAATCGATACCGGGCTCGCCATTCGATTCGACCCCATCTACCTTTGATACTCAGGTCTTTGTTGAGGTTCAATTACGCGGGACTCTCTTC
CCCGGCACGGGTGGTAACCAAGGCGAAGTCCAATCACCCATAGGAGGAGAGATTCGCTTGCAATCTGACCACGACCTTGCCCGTGACTCACGAACAGCATGCATCTGGCAGTCCTTTGTC
A
ACAACCAGGCTAAGATGCAAACGGAGTTCAGGTCCGCGATGGCGAAGCTCGCTACTCTCGGCCAGGACACTTCGAAGCTGGTTGACTGCTCTGACGTCATCCCAGTTCCTCCACCATTC
ACTGGCGCCGCTGTCTTCCCTCCTAGCTTGACGAACGAGGACGTTGAGCAGGCG
TGCGCTACGTCAGCATTCCCAACATTGTCTACACTCCCTGGTGCAGCGACATCTATCTCCCCTGTC
CCTGCGTCTTGA

Retrieve as FASTA