Entry information : SbPrx02 (Sobic.001G080200.1[2.1] / Sb01g007230[1.4])
Entry ID 965
Creation 2008-11-16 (Christophe Dunand)
Last sequence changes 2008-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-01 (Messaoudi)
Peroxidase information: SbPrx02 (Sobic.001G080200.1[2.1] / Sb01g007230[1.4])
Name (synonym) SbPrx02 (Sobic.001G080200.1[2.1] / Sb01g007230[1.4])
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx02
start..stop
S start..stop
ZmPrx74 585 0 1..326 1..325
SiPrx163 565 0 1..326 1..324
OsPrx51 543 0 1..325 1..323
BdiPrx01 493 2e-177 1..326 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6183969..6184184 216 N° 2 6183575..6183775 201 N° 3 6183224..6183389 166 N° 4 6181491..6181888 398
complement(join(6181491..6181888,6183224..6183389,6183575..6183775,6183969..6184 184))


exon

Literature and cross-references SbPrx02 (Sobic.001G080200.1[2.1] / Sb01g007230[1.4])
Literature Klein,R.R. et al., unpublished
DNA ref. Phytozome 11:   chromosome_1 (6184184..6181491)
EST ref. GenBank:   BI141096 [5' end]   BI099504 [3' end]
Protein sequence: SbPrx02 (Sobic.001G080200.1[2.1] / Sb01g007230[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (301)
PWM (Da):   %s   34086.11 (31848.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   4.37 (4.31) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAGIRILAAFLAVLAAAAAGGVTAQLRQDYYAAVCPDLESIVRDAVSKKVQAQPVAVGATIRLFFHDCFVEGCDASVILVSTGNNTAEKDHPSNLSLAGDGFDTVIQAKAAVDAVPACTNQVSCADILALATRDVIALAGGPSYAVELGRLDGLVSMSTNVDGKLPPPSFNLDQLTSMFAVNNLSQADMIALSAAHTVGFGHCSTFADRIQPQKEDPTMNATYAVDLQAACPTGVDPNIALQLDPVTPQAFDNQYFVNLVNGRGLLTSDQVLYSDARSQPTVVAWAQNATDFELAFVDAITRLGRVGVKTDPSQGNIRRDCAFLN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCGGGATCAGGATCCTGGCGGCGTTCTTGGCGGTGCTCGCGGCCGCGGCCGCCGGCGGTGTGACGGCGCAGCTGCGGCAGGACTACTACGCGGCGGTGTGCCCGGACCTGGAG
AGCATCGTGCGCGACGCGGTGTCCAAGAAGGTGCAGGCGCAGCCCGTCGCCGTCGGCGCCACCATCCGCCTCTTCTTCCACGATTGCTTCGTCGAG
GTGCGCGCCCGCCCCCGCCTTCGT
TCCTTGCTCCATTTCCTTCCCAGAGCTTCGATTGGAGATCCCGGGCGGGCTAGCGAGCGTGCCGGGCTGCGCGCGCTCTGTCCCATCGCATGTGCGCTTAATTGCTTGCCATGTGAGTGT
GTGAGTGTGACTGTGACTGACTGAGGCTGCGATGAATGAGCTTTTGCAGGGCTGCGACGCGTCTGTGATCCTGGTGTCGACGGGGAACAACACGGCGGAGAAGGACCACCCGAGCAACCT
CTCCCTGGCCGGCGACGGCTTCGACACCGTCATCCAGGCCAAGGCGGCCGTCGACGCCGTGCCGGCGTGCACCAACCAGGTGTCGTGCGCCGACATCCTGGCCCTGGCCACCCGGGACGT
CATTGCCCTG
GTACGTCGTGCTACCTCCTTGCTCGTAGCACGCACGCGGCGCAAATCAATGCCGCACGAATCGCACCTTTCCGGCCCGAACCAAATCTCCCGAACTTTTGAGGATTCCCT
GCGAAGTAAAGCGTAGTAGTGTAGTACAGCACTACGGCTACAGGCTTTGGAAGTGACGGTTCTCGATTTTTGCAGGCTGGCGGGCCGTCGTACGCGGTGGAGCTGGGGAGGCTGGACGGG
CTGGTGTCCATGTCCACCAACGTCGACGGCAAGCTGCCGCCGCCGTCGTTCAACCTGGACCAGCTGACGAGCATGTTCGCCGTCAACAACCTGTCGCAGGCCGACATGATTGCTCTATCC
G
GTGAGTAAATTATTACTGCTCCAACCAAATTACTACTCCAAGTCTCCAGTCAGTGCTTTCTTTCTTCTAAAGAAAAGTTCTAGTCCAACTGCTGTACCAGCATTAGCGAAGTACTCCCT
CCGTCCACGAAAGAGTCAATTTCTAGAGTTGTCCTAAGTCAAACTTTTTAAACTTTGACCAAATTTCTAGAAAAAAATGCTAAGATTTATAGTATCAAATTAGTATTATTAGATTCATCA
TAGAATATATTTTCATATAATGTGTATTTTATATTATAGATGTTGTTACTCTTTTTTATAAAGTTAGTCAAACTTTAAAAAGTTTGACTGGCACGAATCCTAGGAATTGATTCTTTCGGG
GACGGAGGGAGTACGTACTTACACAGGCTAGATTTCCATGTGCTCCCGTTCCATGTCTTTCAAGTCAAGCAAAGGGCCCAACCCAACCAAACCAAGGCCAACGCCGCCCACCTCTGCAAT
TAAAACTGTAACATTTTGTGTGGTCTCGAGGGATCCGTAGCACGATAGAAAATGCATTATCCCCCTAGGTTAGAACAGCAGAGTGCAGAGTTGATCAGTTTTATTATCACAGACGAATAG
TAGTAGAGTGTGTGGCACTGCAGCTGAGTAGTAGATCTGAAATGGGTCAACTGTGGCGACTGTCTCTGTCTGGAATGCTTGGTGGCCGTTCTTGCTTGCACAGTTGCACGTGAAAGAAAG
ATCAGCATCGCATTATTGTATTGTACTCATACCATGGCCTCCACTGCTTAGGTAGGCATAATCCGACCCAGAGACCGTTTGCTACTGAGACAGCGCCCAGCTACATTATTCGGCCCATTG
ATTGAGGCACATACAGGCCTGCCAAATGAGCTGTCCAAGGCCTTGTTTAGTTCCAAAATATTTTGCAAAATCGACACTGTAGTTTTTTCGTTTGTATTTGACAAATATTGTCCAATTATA
GACTAACTGGGCTCAAAAGATTCATCTCGTCAATTTCGACCAAACTGTTTAATTAGTTTTTATTTTTGTCTATATTTAATACTTCATGCATGTGTCTAAAGATTCGATGTGACGGGGAAT
CTGAAAAATTTTGCAAATTTTTTTGGACTAAACAAGGCCCAAAAAAGAAACAAAAACTCGTGGCATCACGAAGCAGGACTGCAGGAACACACCGCAGAGAAACATATTTTTTAAATTGAA
AAGAAAAGGTTTCTGCACTGCAATCTGCATACATGATGATCCACTGAAAACTCTGAGAAACAGCGTGAAATTTGTATGCGTGTTGGTTCCGAGTGGCACGTTGTTGAACTGTTTGTTCCT
GTTGCAATCCTTGCAGCGGCGCACACGGTGGGGTTCGGGCACTGCAGCACGTTCGCGGACCGGATCCAGCCGCAGAAGGAGGACCCGACGATGAACGCGACGTACGCGGTGGACCTGCAG
GCGGCGTGCCCGACGGGTGTGGACCCCAACATCGCGCTGCAGCTGGACCCCGTCACGCCGCAGGCCTTCGACAACCAGTACTTCGTCAACCTGGTGAACGGCCGCGGGCTCCTCACCTCC
GACCAGGTGCTCTACTCCGACGCCCGGTCGCAGCCCACCGTGGTGGCGTGGGCGCAGAACGCCACCGACTTCGAGCTCGCCTTCGTCGACGCCATCACCAGGCTCGGCCGCGTCGGCGTC
AAGACCGACCCGTCGCAGGGGAACATCCGCCGCGACTGCGCCTTCCTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCCGGGATCAGGATCCTGGCGGCGTTCTTGGCGGTGCTCGCGGCCGCGGCCGCCGGCGGTGTGACGGCGCAGCTGCGGCAGGACTACTACGCGGCGGTGTGCCCGGACCTGGAG
AGCATCGTGCGCGACGCGGTGTCCAAGAAGGTGCAGGCGCAGCCCGTCGCCGTCGGCGCCACCATCCGCCTCTTCTTCCACGATTGCTTCGTCGAG
GGCTGCGACGCGTCTGTGATCCTG
GTGTCGACGGGGAACAACACGGCGGAGAAGGACCACCCGAGCAACCTCTCCCTGGCCGGCGACGGCTTCGACACCGTCATCCAGGCCAAGGCGGCCGTCGACGCCGTGCCGGCGTGCACC
AACCAGGTGTCGTGCGCCGACATCCTGGCCCTGGCCACCCGGGACGTCATTGCCCTG
GCTGGCGGGCCGTCGTACGCGGTGGAGCTGGGGAGGCTGGACGGGCTGGTGTCCATGTCCACC
AACGTCGACGGCAAGCTGCCGCCGCCGTCGTTCAACCTGGACCAGCTGACGAGCATGTTCGCCGTCAACAACCTGTCGCAGGCCGACATGATTGCTCTATCCG
CGGCGCACACGGTGGGG
TTCGGGCACTGCAGCACGTTCGCGGACCGGATCCAGCCGCAGAAGGAGGACCCGACGATGAACGCGACGTACGCGGTGGACCTGCAGGCGGCGTGCCCGACGGGTGTGGACCCCAACATC
GCGCTGCAGCTGGACCCCGTCACGCCGCAGGCCTTCGACAACCAGTACTTCGTCAACCTGGTGAACGGCCGCGGGCTCCTCACCTCCGACCAGGTGCTCTACTCCGACGCCCGGTCGCAG
CCCACCGTGGTGGCGTGGGCGCAGAACGCCACCGACTTCGAGCTCGCCTTCGTCGACGCCATCACCAGGCTCGGCCGCGTCGGCGTCAAGACCGACCCGTCGCAGGGGAACATCCGCCGC
GACTGCGCCTTCCTCAACTGA

Retrieve as FASTA