Entry information : CsuCIIBB03 (MnP13)
Entry ID 9651
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: CsuCIIBB03 (MnP13)
Name (synonym) CsuCIIBB03 (MnP13)
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuCIIBB03
start..stop
S start..stop
CriCIIBB01 631 0 1..363 1..363
GsppCIIBB07 546 0 1..363 1..365
BaCIIBB03 526 0 1..363 1..364
HanCIIBB07 519 0 1..363 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1607900..1608300 401 N° 2 1608355..1608422 68 N° 3 1608476..1608487 12 N° 4 1608542..1608659 118
N° 5 1608716..1608911 196 N° 6 1608970..1609015 46 N° 7 1609065..1609302 238 N° 8 1609359..1609371 13
join(1607900..1608300,1608355..1608422,1608476..1608487,1608542..1608659,1608716 ..1608911,1608970..1609015,1609065..1609302,1609359..1609371)


exon

Literature and cross-references CsuCIIBB03 (MnP13)
DNA ref. JGI genome:   scaffold_7 (1607900..1609371)
Protein sequence: CsuCIIBB03 (MnP13)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (343)
PWM (Da):   %s   37811.79 (35821.6)  
PI (pH):   %s   4.29 (4.20) Peptide Signal:   %s   cut: 21 range:21-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKPLAALVALLSVSIAHGAITRRVTCPDGVNTVANAACCPLFAVRDDIQESLFDGGKCGEEVHESLRLTFHDAIGFSPSLTAQGKFGGGGADGSIAIFESIETGYHANLGIDEIINEQATFILKHNMTAGDFIQFAGAVGVSNCPGAPQLEFLGRPAATAPAPDKTVPEPFDTVDSILARFGDAGFSPQEVIALLASHSVAAADHVDPAIPGTPFDSTPSDFDPQIFIEVQLRGTLFPGTGGNQGEVESPYPGEIRLQSDHLARDSRTACFWQSLANNQQQMQAQFKAAMAKLAVLGQDVSQMVDCSDVIPVPLPPATTPHIPAGLSQNNIEQACATAAFPTLPIDVGPQTSIPPVPGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAACCCCTTGCAGCCCTCGTTGCTCTACTCTCAGTCTCCATCGCTCACGGCGCGATCACTCGTCGAGTGACCTGTCCTGATGGCGTGAATACAGTGGCCAATGCCGCATGT
TGCCCCCTCTTCGCAGTGCGCGACGACATCCAGGAGAGCCTCTTCGATGGCGGCAAGTGCGGAGAGGAGGTGCACGAGTCGCTTCGCCTGACATTCCATGATGCAATCGGCTTCTCGCCC
TCCCTCACTGCTCAAGGCAAGTTTGGTGGGGGCGGCGCAGACGGCTCTATTGCGATCTTCGAGTCCATCGAGACCGGATACCACGCGAACCTTGGCATCGACGAAATTATCAACGAGCAA
GCGACATTCATCTTAAAGCACAACATGACTGCGGGTGATTT
GTGAGTGACATCGCATGTCCTGTCAACATGAGACTGATATACTCATCTGCATAGCATCCAATTCGCGGGTGCTGTCGGT
GTCAGCAACTGTCCAGGTGCACCGCAGCTCGAGTTTCTACTAG
GCACAAATGTCTCTTGCTTTACTTTGTTATTCTGCTGACGTTTTATTTTGTAGGACGTCCGGCAGGTTTGTCCGACA
TAGCAGTCAGTAAAGAGTCGCCACTTAACCTTCCTTCATAAGCCACCGCTCCGGCACCTGACAAGACTGTTCCGGAGCCTTTCGATACTGTCGATAGTATCCTTGCACGCTTTGGAGACG
CCGGGTTCAGTCCTCAGGAGGTCATCGCGCTTCTTGCATC
GTACGCTTTCCAGTGTATCAAAGTGTCTTGTCCCTCATCCTGTTCTCGTCTCGCAGGCACAGCGTGGCCGCCGCTGATCA
TGTTGACCCGGCCATTCCTGGCACACCCTTCGACTCCACGCCATCTGACTTCGACCCGCAAATTTTCATCGAGGTCCAACTTCGTGGCACCCTTTTCCCAGGCACCGGAGGCAACCAAGG
GGAAGTGGAATCTCCGTATCCCGGTGAAATTCGGTTGCAATCCGATCACAAC
GTATGCTTTCACCTTTGCCCACGAAGAAACTTCGAGACTGAGTAGTGATTTTCCGTAGCTCGCACGCG
ACTCACGCACGGCGTGCTTCTGGCAGTCCCTTGCTA
GTGGGTATTTCCCACAGCTCCCATCTCAAGGCATCTGACGACTGTATAGATAACCAGCAACAGATGCAAGCACAATTCAAAGCC
GCCATGGCGAAGCTTGCAGTCCTCGGTCAGGACGTGTCGCAGATGGTTGATTGTTCCGATGTGATCCCTGTTCCTTTGCCGCCGGCAACAACTCCGCATATTCCTGCTGGCCTGTCGCAG
AACAACATCGAACAAGCATGTGCGACCGCTGCGTTCCCCACACTTCCGATCGACGTTGGTCCGCAGACGTCCATTCCGCCCGT
GTACGTGCTAGATGGGCTGGAACATAGTCTCATGCTG
ACGACCGAATCATTTGCAGGCCCGGATCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCAAACCCCTTGCAGCCCTCGTTGCTCTACTCTCAGTCTCCATCGCTCACGGCGCGATCACTCGTCGAGTGACCTGTCCTGATGGCGTGAATACAGTGGCCAATGCCGCATGT
TGCCCCCTCTTCGCAGTGCGCGACGACATCCAGGAGAGCCTCTTCGATGGCGGCAAGTGCGGAGAGGAGGTGCACGAGTCGCTTCGCCTGACATTCCATGATGCAATCGGCTTCTCGCCC
TCCCTCACTGCTCAAGGCAAGTTTGGTGGGGGCGGCGCAGACGGCTCTATTGCGATCTTCGAGTCCATCGAGACCGGATACCACGCGAACCTTGGCATCGACGAAATTATCAACGAGCAA
GCGACATTCATCTTAAAGCACAACATGACTGCGGGTGATTT
CATCCAATTCGCGGGTGCTGTCGGTGTCAGCAACTGTCCAGGTGCACCGCAGCTCGAGTTTCTACTAGGACGTCCGGCA
G
CCACCGCTCCGGCACCTGACAAGACTGTTCCGGAGCCTTTCGATACTGTCGATAGTATCCTTGCACGCTTTGGAGACGCCGGGTTCAGTCCTCAGGAGGTCATCGCGCTTCTTGCATCG
CACAGCGTGGCCGCCGCTGATCATGTTGACCCGGCCATTCCTGGCACACCCTTCGACTCCACGCCATCTGACTTCGACCCGCAAATTTTCATCGAGGTCCAACTTCGTGGCACCCTTTTC
CCAGGCACCGGAGGCAACCAAGGGGAAGTGGAATCTCCGTATCCCGGTGAAATTCGGTTGCAATCCGATCACAAC
CTCGCACGCGACTCACGCACGGCGTGCTTCTGGCAGTCCCTTGCT
A
ATAACCAGCAACAGATGCAAGCACAATTCAAAGCCGCCATGGCGAAGCTTGCAGTCCTCGGTCAGGACGTGTCGCAGATGGTTGATTGTTCCGATGTGATCCCTGTTCCTTTGCCGCCG
GCAACAACTCCGCATATTCCTGCTGGCCTGTCGCAGAACAACATCGAACAAGCATGTGCGACCGCTGCGTTCCCCACACTTCCGATCGACGTTGGTCCGCAGACGTCCATTCCGCCCGT
G
CCCGGATCCTAA

Retrieve as FASTA