Entry information : CsuMnP05 (MnP05)
Entry ID 9655
Creation 2011-11-04 (Christophe Dunand)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP05 (MnP05)
Name (synonym) CsuMnP05 (MnP05)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP05
start..stop
S start..stop
CsuMnP04 687 0 1..377 1..377
CsuMnP10 673 0 1..377 1..378
PsoMnP02 646 0 1..377 1..377
PbreMnP04 646 0 1..377 1..380
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 425545..425664 120 N° 2 425438..425489 52 N° 3 425315..425381 67 N° 4 425083..425257 175
N° 5 424797..425018 222 N° 6 424324..424738 415 N° 7 424184..424266 83  
complement(join(424184..424266,424324..424738,424797..425018,425083..425257,4253 15..425381,425438..425489,425545..425664))


exon

Literature and cross-references CsuMnP05 (MnP05)
DNA ref. JGI genome:   scaffold_6 (425664..424184)
Protein sequence: CsuMnP05 (MnP05)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa): %sProtein length in amino acid 377 (359)
PWM (Da): %sMolecular Weight of protein
Protein Mw is calculated by the addition of average isotopic masses
of amino acids in the protein and the average isotopic mass of one water molecule.
Molecular weight values are given in Dalton (Da).
39439.38 (37637.4)  
PI (pH): %sIso electric point of protein
Calculation done with EMBOSS parameters.
Please see Dataset for pKi calculation for more information
4.23 (4.18) Peptide Signal: %sProtein signal for mature protein.
if exist :cut position of signal peptide.
range: start-end pos of mature protein
cut: 19 range:19-377
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFTSLLALSALVAVSRAAPTAVCSDGTRVSNSACCAFIPLAQDLQETLFMNDCGEDAHEVIRLTFHDAVAISRSQGPSAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFLAKHPVSAGDLVQFAGAIALTNCGAPQLEFLAGRPNHTIAAVDGLIPEPQDDVTKILARFDDAGGFSPFEVVSLLASHTVARADKVDETIDAAPFDSTPFTFDTQVFLEVLLKGVGFPGTDNNTGEVASPLPLTSGNDTGEMRLQSDFALARDSRTACFWQGFVNEQEFMAQSFKAAMSKLAVLGHSRSDLIDCSDVIPTPKPAVNKPATFPASTGPKDLELSCFAERFPTLPVTPGATQTLIPHCSNGGEDCPTVQFTGPA

Retrieve as FASTA  
Remarks complete sequence from genomic (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTTCTCTGCTCGCCCTCTCTGCATTGGTCGCGGTATCGCGCGCTGCGCCGACCGCCGTCTGCTCTGATGGCACTCGCGTCAGCAACTCCGCCTGCTGTGCGTTCATCCCG
GTACGTGCAATAATGATTCCCAGATACAAGTACATGATACCGAACAATACACTAGCTTGCGCAGGACCTGCAAGAGACGCTATTCATGAATGATTGTGGTGAAGACGGTGAATATCGCCT
CATAATACGCATACTCTCAGACATGCTCATGGGTACTCTGCAGCTCACGAGGTCATCCGTCTGACTTTCCACGACGCTGTTGCGATTTCTCGCAGCCAGGGCCCGTCTGCGTACGTATTT
CGGTCTCTAGAATAGAACCAGCACGTGACTGAGTCGTACTTCCGCAGTGGTGGCGGAGCTGACGGCTCGATGCTTCTGTTCCCGACTGTCGAGCCAAACTTCTCGGCTAACAACGGTATC
GACGACTCCGTGAATAACCTTATTCCCTTTTTGGCAAAGCATCCCGTCAGCGCTGGCGATCTCGTCCAATTCGCAGGCGCTATCGCTCTCACAAATTGCCCT
GTAAGCAATAACGAAACT
CTCATGCGTCTCGGATAGTTCCGCTTATGCATAACGTATCCTTCAGGGCGCTCCTCAGCTCGAGTTCTTGGCCGGTCGCCCCAACCACACCATCGCCGCCGTCGATGGTCTGATCCCCGA
GCCTCAGGACGATGTCACTAAAATTCTCGCCCGTTTCGACGATGCTGGAGGCTTCAGCCCCTTCGAAGTCGTCTCGCTTTTGGCCTCTCACACCGTAGCCCGTGCAGACAAGGTCGATGA
GACCATCGATGCGGCTCCTTTTGATTCG
GTCAGTACCCATGATGGCCTTCAACTTCGCACATTGTCCTAACACTGTCCCAATCCAGACCCCGTTCACCTTTGACACTCAGGTCTTCCTTG
AGGTGCTGCTCAAGGGCGTCGGCTTCCCCGGAACCGATAACAACACTGGCGAGGTTGCATCTCCTCTCCCGCTCACCAGTGGCAACGACACTGGTGAAATGCGCCTCCAGTCCGACTTCG
CCCTTGCCCGCGACTCGCGTACCGCTTGCTTCTGGCAAGGCTTCGTCAACGAGCAGGAATTCATGGCGCAGAGCTTCAAGGCCGCGATGTCCAAGCTCGCGGTTCTCGGCCACAGCCGCT
CAGATCTGATTGACTGCTCCGATGTTATCCCGACCCCGAAGCCCGCCGTCAACAAGCCCGCAACCTTCCCCGCGAGCACTGGTCCCAAGGACCTCGAGCTCAGCTGCTTCGCGGAGCGCT
TCCCGACACTCCCTGTTACCC
GTGAGTACATCAATCTCAGGAATTCCGCGCTTAATGGCTCACACGGATCTTCACTAGCTGGTGCAACGCAGACCCTCATCCCTCACTGCTCTAACGGTG
GAGAGGACTGCCCGACCGTCCAATTCACTGGCCCCGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCACTTCTCTGCTCGCCCTCTCTGCATTGGTCGCGGTATCGCGCGCTGCGCCGACCGCCGTCTGCTCTGATGGCACTCGCGTCAGCAACTCCGCCTGCTGTGCGTTCATCCCG
CTTGCGCAGGACCTGCAAGAGACGCTATTCATGAATGATTGTGGTGAAGACGCTCACGAGGTCATCCGTCTGACTTTCCACGACGCTGTTGCGATTTCTCGCAGCCAGGGCCCGTCTGCT
GGTGGCGGAGCTGACGGCTCGATGCTTCTGTTCCCGACTGTCGAGCCAAACTTCTCGGCTAACAACGGTATCGACGACTCCGTGAATAACCTTATTCCCTTTTTGGCAAAGCATCCCGTC
AGCGCTGGCGATCTCGTCCAATTCGCAGGCGCTATCGCTCTCACAAATTGCCCT
GGCGCTCCTCAGCTCGAGTTCTTGGCCGGTCGCCCCAACCACACCATCGCCGCCGTCGATGGTCTG
ATCCCCGAGCCTCAGGACGATGTCACTAAAATTCTCGCCCGTTTCGACGATGCTGGAGGCTTCAGCCCCTTCGAAGTCGTCTCGCTTTTGGCCTCTCACACCGTAGCCCGTGCAGACAAG
GTCGATGAGACCATCGATGCGGCTCCTTTTGATTCG
ACCCCGTTCACCTTTGACACTCAGGTCTTCCTTGAGGTGCTGCTCAAGGGCGTCGGCTTCCCCGGAACCGATAACAACACTGGC
GAGGTTGCATCTCCTCTCCCGCTCACCAGTGGCAACGACACTGGTGAAATGCGCCTCCAGTCCGACTTCGCCCTTGCCCGCGACTCGCGTACCGCTTGCTTCTGGCAAGGCTTCGTCAAC
GAGCAGGAATTCATGGCGCAGAGCTTCAAGGCCGCGATGTCCAAGCTCGCGGTTCTCGGCCACAGCCGCTCAGATCTGATTGACTGCTCCGATGTTATCCCGACCCCGAAGCCCGCCGTC
AACAAGCCCGCAACCTTCCCCGCGAGCACTGGTCCCAAGGACCTCGAGCTCAGCTGCTTCGCGGAGCGCTTCCCGACACTCCCTGTTACCC
CTGGTGCAACGCAGACCCTCATCCCTCAC
TGCTCTAACGGTGGAGAGGACTGCCCGACCGTCCAATTCACTGGCCCCGCATAA

Retrieve as FASTA