Entry information : GmPrx317
Entry ID 9668
Creation 2011-11-10 (Qiang Li (Scipio))
Last sequence changes 2011-12-14 (Qiang Li (Scipio))
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmPrx317
Name GmPrx317
Class Class III peroxidase     [Orthogroup: Prx008]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx317
start..stop
S start..stop
GmPrx327 271 3e-92 1..158 150..307
GmPrx31 270 3e-92 1..158 151..308
MePrx83 201 4e-65 1..158 138..295
GhPrx13 201 4e-65 1..158 144..301
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35353873..35354005 133 N° 2 35353325..35353633 309 N° 3 35189620..35189718 99  
complement(join(35189620..35189718,35353325..35353633,35353873..35354005))


exon

Literature and cross-references GmPrx317
DNA ref. Phytozome 12:   Gm01 (35354005..35189620)
Protein sequence: GmPrx317
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   180
PWM (Da):   %s   20138.96  
PI (pH):   %s   10.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VRLGRMDSKIAHFTVANTGVIPPPTSNLTNLMTRFRDQGxSATDMVSLAGAHTFGKGRCTSFGYCIYNQTNNDKTFALTRQRRCPRTNGTGDNNLENLDLRTPNHFDNNYFKNLLIERGLLNSNQVFFNGGSTDSLIKIYSQNNKAFDSSFLKAMIRMMICKREVHNIYNCIQARSHVEL

Retrieve as FASTA  
Remarks Partial sequence from genomic. No prediction from phytozome (Both long 5' end and short 3' end are missing due to the 'nnnnnnnnn' which are not found).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAGACTTGGAAGAATGGATTCCAAAATTGCCCACTTCACTGTTGCTAACACTGGTGTTATTCCACCTCCCACATCTAACCTCACCAACCTTATGACAAGGTTTCGAGATCAAGGACNNTC
TGCTACGGACATG
GTTCCCTTATCTAGTATTTCTCTTTTTTCCTTCTTTATCTTATTAATTAAAATGTCATATCTAAAGATATTTCTAATTAGTTGCCACTATAAAAAATATTTACACTA
ATAGTGCATGAAAATTAAACTTAATAATTATTAGTGAGACTAGTACTCCATCATGAGACTAACAATAATAAATCAGTTGTTCAAAACTATATAGGAATATTGAGCAATTCTATTTATGGT
ATTTTGTGTGTGGTTTCACTTGCAGGAGCTCACACATTTGGCAAAGGAAGGTGTACTAGTTTCGGATATTGCATATACAATCAAACCAACAATGACAAAACTTTTGCATTGACCAGGCAG
AGGAGGTGTCCTAGGACTAATGGCACAGGTGACAACAATCTAGAAAATTTAGACTTAAGAACTCCAAATCATTTTGACAACAACTATTTCAAAAACCTTCTGATTGAAAGGGGACTCCTC
AATTCTAATCAAGTGTTTTTCAATGGTGGATCCACAGATTCACTAATCAAAATTTATAGCCAGAATAACAAGGCATTTGAT
ACTTGACTTTGTTAAAGAAATTATTAGGATGGGAGATAT
TGAACCCTTAATTGGGTCACAAGGCGAGATTAGGAATATCTTGAAATCTTAGTGAAACTTCCATGTTTTCCTAATTAATATTTTAAGTTAATTAGTATAAATGTGTTGATGGCCTCCCCA
AGTCCTATATATGCAGGTGACATGGCTAGTTGATTTCCTGTTGGGACAAGATGCTGACATTTTACTATGAAAGACTTGACTTAAAAACTGTCAAAGGATGACCAATAGCTTGATCTACCA
TTCCACCCTTTAGGACAAATAACTATTAAGTAATGTCTTAATATGCGAATCTTGACCTTTGTTCTAAACTCGTGGAAACAAACCTCTCTATTATTTAGAAATAGTTTAAACTTAATACAT
AGGCCTCAAGGAGAAATATTAGGTATTCTTCATTATCAAGTTTTCTAACTGTTGCATTTATCTATTTCAGGGAAGAAAAACTATAACATCAGGCCAAATTAGTTATAGTAAATACAGGAC
AGATCCTAGCTAGTTCATAATTGTTGCACTCATTTCATATTTGGCCTACAAGTTGAACACTAATCTAGGTATCTCACTTACCATGTGAACAAACTTAAAGCTTAAGGTCAAATTTATCTT
TAATAGAGCTAAGAAGGATTTGGAATTGTAGCATCCCTAATTTTCAACTTCTCAACGACTCTTCACACAGTGACACTTCACTTAACATCCTTATTGGTTAGAATCCTCCACCAATTAGAA
CCCTCTGTAGGTAGCCCTTTCCAAGATCTCGAAAACTAATTCTGCCTACTTTTAGGATCAATGGTTGATCCCACAAACCAACATAAGATTTTTCAACATGTTTTATCCTCACTCACGCTT
TTTGGGAAACTTCCCAGAAGGTCACCAATCCCATAACTATTCCAAGACAAGCACGCTTAACTATGAATTTCTTAAGTAATGGGCTACCAAAAAGTAAATGTATCTTGTTGGTATAGGTAG
TACCAATTAATTATTTAAGTCATCCTCAATTATACAGTCTCATACTTGCACAACCTCTGGATCTCTCTCTTTCTAGTGTGATTCGTCAAGGTGTCACAAGAATAATGTAATCCTAAGTTT
TAAACCCAAACTAAATAACCTATCTACCTCTAATTGATTTACATCATAGAGCGAAGAAGGACATGGAAGGCATTGATGATATTTATATGGTTAGAATTAGTGAATTCTTTTGGTTTTTCT
ATGTTGCAATGGTGCGTTTCAATTATTCTGGACATGATTGGTCACACACACTGATGATAATTCATTTTTGTGACTTCAACTTCCTCAATAGGGCCAATGTTCTCAGCTTTTTATTCCTTT
AACAATGACTAATAGATGACTTAAACTGTCTAACAATGATAGTGCAACTATCCGACAGGGATAGGGGGCCTACTTAAACCCTAATATAAGGCTATTTAGTAACAGTCCTATATTAATTTA
AGCATTTAACTGAAAATGAACAAGAGCATCAAGGATTGAACTCCTAAACATGTGGCCATTGAAGCTTTGATATGTCAACAAACAAGGGGACTAACAATAGTGTTAGCATGTGTTTAGCCT
CTGCATAATTTTTTTTTATCCCCTTTGGGCTTCTAAGTTAGACAGTGAACTCTGTCACTGACCATCTATGAATCTTCAAGTCATATTTTACAAGGCTAATTAGTTTTGCAACAAGGTACT
ATTTTTTACTATTTTGAAATTGTACAAATCTTCTACCAGTGTTATGGTTAATTTTAAAAGCAAAATATATTGAATTATCAAGGTCGAGGGAAATAGAATTGACTGAGATAAAAGAATCAT
GATTAAACTCTCTTTATAATTCACATTTAAGTATCAGTAGTGTCCACTACAGCTTTAAAAATCATGGTCATATGTGAATGGTTTTACAGATAATTGTTCCAGTGAGAAAGACAATTATTT
AAGAGACATTATGTTCCTACACCATCTAAGTTAACATTCTAAGCTAAAAAATTGAAATTGGTCGTTGAAATCTACATGCATTCAAGTTGCTACTAGCTTCTACCAATTCCTCGTGCATTT
AACACCCTAAACTTAAAAGTTGGTTTAAGGGTAGCAGAAAAAAAATTAGTATTACTAGTAGTAGTGTAGTATATTTAAGCCTCTGCCCATTGAGTTAAAAAAGTTGCTTGCAATTATGAA
ACTTTTACATAACTTGGTATGTCTTAAACACCAAAGTCTCTTCTTCCCTTTCCAGATTTTGTGACCTTAGCTTTTAGTTATTTTTTGACCTTATTAGTAGTACTAGTTTTAGTTTTAACA
TATTAGAAAAAAATGTTATCTCAGAAGCAAGCTAAAGAAGCCACATTATACTGCATTCTTACTAATAAGGTAAATCCATGTTATGTAATACCCCTTTTTCAGAAACAACATAAAAGGGGC
TATTCTTTGAAATCTCACAAATTCAATGTAGCTTTTATAATTTGTTGAACTCCCAAATTAACATGTGGGGGGTTTTGTGATATAAAAAATAAATAGAAAAATGAAGTGGCAACCTTATTC
TCTTCTACATTAAAAAAAAAGAGCAAGTGAAACAATTTCGTGACATAAAGAAGTAACCTTAATTGTTGATAATTTTAATTAAAAAAAGTCTCACCTTTGAAATCTTACATATGTTGCTAG
TATCTATTATACATATCTTACTGTATATGTTCTCCTATAAGGTTCAAAGATACCAGAGACACAAATCAACAAAAATCTTTATGGACTCCATGAACCATCCTTTAACATGAAATAGAAGAA
AATGTGCAGAACCAATACATCCAACCAAAACATGAAAGAAGAAGCAGAAATGTAGCAGCAATACAAAAAATCAATAATATGAACAGTTTTTGAGTAGATGGCATAAACTATACATGAATG
AGAACCAAATGAGGATTAGTCCATATAAAGGAGCTACACAAATAGATCTAAAAGCTATAAGTTTTTTAAAGGGTGCAGTGAGGAAATTCCTTGCTCTTTAACTAAGGCAAAAATTTCATA
GCATCATTCGACCATGTCTTCAAACTGAAAGACTAATTTAAGCACTTACAAATACAAACCAAATTACACATATCAACTTTATGTGTTTTCTCTAGTAAAATTCCAATGATTTAAAACAAT
TAATCAACTTCATCTCACCCACTAAAAAAAGAATTCTTGAAGAAAGAATATGTAAAAGAAAGAATTCAGAACCTGTAATTACAAACTATAATTGCAAGGAAGAATCTTGCAATTATGCAA
TTATGCAGTTAGAAAATATCAACTTTGTCCCCAACTTGAATATGACATAATATATGTGCTTCCTTTTCACTTTTACATTATGTTCCATAATAGACCCCATATATATGAAATTACTTGACT
TTAAAGTGATAAGGTATCAAGTTGCCTATTTTAAACACAGTTCTAAAATTTTGGACTCTTTAAGATATATGCACTTAAATATTAAAAGGTCCTCTGCTACCAATTTTGGATGTCTAGCGC
GTATTCATACTTCTTTTATATAACAGACCCAAATCGATACATTTGGTCCTTGCATACACTTAGAAATCTATAACAAACCTAATAACTCTAATCGTAGAGGACCAAATCGCATGATTCATT
ACAGTTCTCTTCATCAAGTGGTAGAATTGGGCCAAGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNCTATTTCAATTCTTTCAATGTTGTCCATGAGCTCTTCAATGTCAATTGATCATGAGAAGAATTGACACCAATTTTGTGTACAAACCAATGCTTCAACGGTCTTTG
GGGAGAGAAAGCTCCTAAAACAATTAAGCACTCTAACTCCCTTGCTTAAAGCATACTCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAATACTTTTCTTCTCCAAACTCTCCATGAGATACAAATCTACTTCATTTTTATGATTATTGATATTAAGATTCATGTT
TTTCTCAAATTCCATAGCAAAAGAAATTCCAAGTGCATCAAATTCATCAATTTCCATATCAACATAGGGTTATGTAAAATTTTCAGCTTGCTGCCCATTAGCACATACACATCTAACATA
GTGTATAATGTGTCCTTCGCCCTAGTACACAAAAATCCAGCTTTTTCCTTCTCATAAAATTTGCTTAAGCCCAACTACACAAATTGAAACTTAGTCTGAGGATCAAGCACTGCAACAACA
AAGATCAAAATATTCATATTTTTAACATTCCCCCGATATTTATTATATTTAACTTTCAAATTTTTAGCCATGCTTCCAAACAATGGGTCAAAACTCCCTATCCATTTCTAAAATGCTTGT
AATATTTTGCAATGTTCATTGAAATATTGAGAAGATGTTTACTCCCTGGAACTTTTTGAGTAATATCAAAAAATATTTTCAAGAATGTAATAAAGCATCTTACATTTTCCCAATCCTCAT
TATTTGGAATACTACCCTTCAACATCACATATTCAGAAATCTTTCACCTAATCTTTTAAATGCTTTCTGAAATTTCAATGCACTTTCAAGCATTATGTAGGTGGAGTTCCACCTAATGGA
AACATCCAATTGCACAATAGATTTGTCAACTATCCTATCTTTCTTGATACAAGTTTTAAATCTATCCATGCGACCAGGTGACGCACGAACATATTTAATAGCATTCCTAATTTTTTTTAT
TGAAGAATAATACTCCTTCAATCCATCATTGATCACAAGTTTTGAAATATGTGCTCAACACTTAACATGCAAGTGTTCTCCTTTTAATGGATGTGTGTTCCAATCTTTCATTTTACTTTT
CAAGTGAGATATTGCAACATCATTGGAGCTAGCATTGTCTCTTGTGATGCTAAAAACTCTACCAATTAGCCAACCCTCTAAGCATTTCTCAATTTTTCTACCAATGGTTTCCCTTTTGTG
CTTTGTCATTGGAAAAAAGAATGAGAATCCTTTTATGCAACTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCGTGAAATTGTTGAGGGGTTTTACTCCGCGTGGATTGAGAAATA
TTTTTGAATAATTTGTTTGTGTTTTGAATAAGATTAGCGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNTCAGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCAATGAAATGCATAGTAAGACAGAGATAACTCAAATTTTGAACAAAACTCCAACAATCAGTTGTAAGACTTACA
CCTTGATTTGAATTAGTAAACATACTTTTCAACTTCTATTTTTCATTACAATCCCTGACAATTGTAATCCTTCCTAGAATTGGAAATTTAGGTTGCAAGACACTCATAAAAAAGCAAAAT
CCCTCTCCTTCAATAAACTTAAAAGACAACTCATCCACAATTATCATTCTAGCTAAAGCTTGTCTACATGCATCAACATCAAAATGAACACCAATAAGAACACTACAACTTCCTTTCTCA
TATTCTTTTCTCATTTGTTGAAATGCAAGAGTTTGTTGAGAAGGATCAAGAGACTCTTTGGGAAACTTTCTACATTTATACACCAAATGATTTATAAGATTACTTGCATCATTTTTAGCT
CTACACCAAATGATTTATAAGATTACTTGCATCATTTATGCAAGAGTTTGTTGAGAATGATCAAGAGACTCTTTGCGAAACTTTTTACATTTATACACCAAATGATTTATAAGATTACTT
GCATCATTTTTAGCTCTACACCAAATGATTTATAAGATTACTTGCATCATTTTTAGCTCTACACCAAATGATTTATAAGATTACTTGCATCATTTATGCAAGAGTTTGTTGAGAATGATC
AAGAGACTCTTTGGGAAACTTTTTACATTTATACAACAAATGATTTATAAGATTACTTGCATCATTTATGAGAATCAACAACATAATCTTTTGTGCACCAATTACAATTAGCTCTATAGA
TGTCCTTAATTTTTTCAAAATGATCTAAACACCAAGATCTAGGCCTACAAGACCTGTTACCTGGATCTCCAACATTATTAGGTGTTGGTTCTTCTTCAACTTTTCTTTTCTTTTGAGTGT
TTCCAACATCTGATTTGGAGTCTCCCGCTTACTTCAAAGAATCTCGCTCCTCCTCCACATTTTTTGGTTCATTTGAAGCCTTGCCAGATAGAGAATTTGTAGTTTGCTCTCTATCACTAC
TTTGAGTGTTTTTCAGCCTGCAAAACATGTTGACAAAACATCACCTTCATACATACTTTAAATAAATAAAAGAAATATTAATTATGTGATAGGGGAAGAGACTACCTCCATGGTGTGATG
GTGGATTAATGGATTTTGATAACTTGATAAATATTGCACCCACAATGCAAAAAGGAAAAAATAAAATAAAATAATTATTAAATCTATTACACCTACAATGCAAACTGAACCAATTTTTGT
TTTTGTTCACAATATGTATGTAGTATGCTTACTTATTGTGTTGGTACATGGTACAACCATATATATTTATGCTTATTATGTTATCTCACAGACTTTGAGTCACTGACGATGGTGGCTCAC
GGTGATGATTATGCTTTGTGAGAGTTAAGAGGAACGCGAAAGAGGTTGAGAAATGTGAGAGTCGAGTCTTGTGAAAGTGGTGATGCACGTTGGCTCGGGTTCAGATTTGTGAGAAAGGCT
GAGACTTATGAGAGTGGTGGCTAATTGCGGCAGGCTCAAGTTCAGATTTGCGACAATGGTGGCTCACGTAGTAGCTCATGGGTGCAAAACTACAAATTTTTGAGAGAGTCAGAGAAAGAG
AGAGGTCGAGAGAGAGTGGAGTGGTGGTAGCGGGCTAGTGGACAGTGGCGTAAACAATGTGGATGTGTGGAGTGAGAGATGGTGGAAGAGTTACTAATTTTGATTTTAGGTTTTCTTTAG
TCTTTACTGAGTGAGACTGTGAGTGTGAGAGTGAGTGAGTGTTAGTGTGGATGGTGCTATTTTGGTTTAGGGACTACAGTCTACTTGCAGTTCGATTCGATTTGGATCAGTTCCAAAGGC
TCAAACCATACCACTTGGTTAACCAAATAAAAAATACAAAAAAAAAAAAACAAAGAGACTTCGCTTTTGATTGGTTATGGTTAGGATTTTATTTCATGTTAGATTCAACTTATATGTCAA
GTGTAACCCAATCATGATGTAGTAACTGAACTATCATCCAGGTCGTCTCCTAAAGGAATAAAAGAGAGATTTCATGTAATTATTTAACTAAAAATTGGGTTTTGGTATTTTTGTCTTGTG
ATTGTCACAAAATAAATAACATAAAATAAATTGCAATAAAAATTAAATGACAATAAAATAATCAATTAAAGATAGAAATACTAGACTTAGATGGTGACGTCGATCTTGATGAATAAATGT
CTAGGTTTGGACTTGAAATTTGTTCCATGCACTGTAACTTTACAATTCACGAATGTATTCTACCCCAGGTCCTACATGGTCGTAGATTCTAAACTAGAGCTTATAATGGAATAATGGGGG
CGTCTAGTAAGTATTGAAAAAAAGCATTAAGTATGAAAACAAATAAATTCCTGAATTCATCTATAAGATGGTCAGTCAAATAAAAAAAAGCATTAAGTATGAAAACAAATAAATAACTCA
AGATGAAGTATTGAATTTATATAATTAAAGCAAAACAAGGTTCATCCTTTCCTCTCCTAGGTGGAAGGCATTGCATTCAGAAAAATAATACAATGAAACCTAGAGCTTATAATGGAATAA
TGGGGGCGTCTAGTAAGTGGAAGTCTAAAATATAATTGTAAGAACTTCTTGGGACTTCTACACTATTACAATAAATGCCTAATCTCCTATTTATAGAATTATAACTAGGTTTAGTTAATG
AGATAATCACAAGAAATTACAAACAAATAATATCTCTAATTAATTTAAGTAATTATCTTCTTCTTCATCTGATTTATCCTTGAAAAATATCTTGCTCTTAATTTTCCTAGTTTTTATCTT
CAATTTTCACAATTTCTTCTTCTAGAACTTTCTACTGATTTTGGGCCTTTGGATCTCTAGCGCCTAAGCGAGAGATTGCTCGCTTAAGCGAGCCAATTCGAATTTTGAGTTTTGCTCTTT
GTTTGCTGGCACTTAAGCGAGCTTCTCGACGCTTGAGCGAGCTCCTGCCACAATGACCTCTTTTTGTAGAAAAAGTATCAAAATTTCATTAAAAATAACTAAAACATAAACTTTTACCTA
AGATAAAGTAAAAACTGAATTTAAAGCTAATTTGGTTTAAAACAAGGCATAAAGTTAACTAAAATATCAAATAAACTTCACAAAATGCATATCAAAATACTATAAATTTGACGTTTATTA
GTTATCGGTTTTTTGGGTCGATTTTTGGTTATTTTTTTGGATTCTTCCGGTTCTAGACACCTCTATTTTGAAGGAATAAGAATTCCTTTATTTTTGTGGATCAAATTTTGGATAATGTTA
AAACTATTAATGTTAGCCTCCAGCACATTAAAGAGCTCTTAAGCCGAGGCAAGTTTAGACTTCCTCATGTTCTCACATTCTCACATTCGGTGGTGTTGTCCTCCTGTGAATTGTTTTAAA
CTGAATTGTGATGCAAGTATTATTCAAGCTTCTAAGAAGGCAACAGTTGGTGGTGTTCTTCGTAACCACAACGGAGCTGCCATCTTTGCTTTATTGTNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGTTGTTGACCTTTCTACATGGAATTCGTGTAGCTTGGAGTAGAGGATTTAAGGTTCTCATTGTTGAATCAGATTCT
AAAATTCCAATCACTCTGTTAACCAAGGGGTGTTCTACTACTCATTCTTGCTTCAACCTTGTACAGAGCATTAAGCACTTTATTCTCAATGGTGATGTTTTCAGCTGGACTCATTCCTTG
CGAGAAGGTAATCAAGTAGTTGATTCTGTGGCAAATCATGGTTTGACCTTGAATGGTCAGTTACGTATTTTTTATTTTGTTCCTAATTTTGTTTGTAACGTTGTTATGGCGGATGTAAGT
CCTATTGTGTTTTCTCATGGTTTTTCATGTTAGCTTCTAGGGGGCAGTTCCCCTCCTATTCACCCAAAAACAAAAAATATGTCTAATTAAAACAATCAAATATTCAATATATCAACCAAC
TTTCAATAAACTATAATTAGCATGAAAATTAGTATTTTGTGGTATATTTATATTTGATATTAATCTTTTATTCTAGTTACATACNNNNNNNNNNNNNNNNNNNNNNNNNNNCCATACACA
TAACTGTTTCTTCTAACTTAAAATTTTTAAACTAAATTTATTAACGTGACTAAAATAAACAATAAGGGATAACTTAGAATCCACATCTAATTTTATCAATTATAAAATACAATTTGATTA
ACAAAATTGAATTACAAAATAAAAAATTACTAATTCTCAATTCATAATCCTTTAAATAGAAGATTTTTTTAGAATCCTATAAAATAGAAGATAAACCATAATCTTATAAAATATACCCGT
AATTGGATATTTTTCACATTTTATTTTGATCAAGAAAAAATATATCAAATCAATTTACATTGTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTACATTAA
TTGAATTATTTGAATTGCATGAATATAGGGATCCCAAGTGACATGGATGCCAAATGGCATCACCCATAGAATAAAACCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATCTTATATGAGAATAAGAGGATTAAATATTGTTTGTATAATC
ATATAGGAAATGTCAAGATTTAATGCTATGTGTGATTTTTTAAGTCTTAAATATTGACTATTCATGTTTGGTTATACAATCCTCTGTATATAGAAAAAATAAAAGGAGAGATCAAATTGC
ATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATATCGATGTAATTGCTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAC
TTAAAATAATGATACTGAATAAAAGTGTTGCACGGGATAATTGGAACTTAAGATCATGCGTGACCAATATTTGAGCAACACTAGCAAAGTCTAGGCGATTCACAACAGAAAACAATAACT
CTTCAGCATTGATTTGATTTCTCTAAGGTGCTTTTAATTTAGACGAGCTACTCACTCTTAGAAAGTGAACAGCAGCAACTCAAACCGATTGAAATGCAAGTAATTTCCCCCTATTCTACA
ACGAACATTTGTTAGCAATAACAGGTTCCCAAATCAAGTCCTAATCGGTCAACAGTCCAAGAACCTCCTTTTACCTAGTGAATCCATTTACATTATAGCAGTGATTCACACATAACTTTG
ATTTCCTAATTAGATTTGCAAGGAAAATAGGTTGCCATCACTATAGCTTTTATCATACCCATTATCCAGTCCTCACTCAGAATAGGAATGATGATCTATTTGGCATTTTAATGGCCAATA
TGTACTTGAGATCCATTAGATACTACCCTTCCAGAGGTGTTGCCCATCATTTTGGCACTACTACTCTCCAATCCACTTTTAAGCCAAGCAAGGTTACTAATGTCTGTAGCTATTGCAGCC
AACTCAAAATTTGGGAAAGATGGGGGTTCCGAAAATTCAACAAATTCGGGTCCCAACAAAGAGCTTTCGGACTTTCTACCATCTGGAGCAGCACAGCAACCATGGCCACACTGGTGAGGC
ACTGACTGATCACCACAAATTCCTTCAAGCATTCTACAAAATTCCATGTCTGGTTTTGATGATTGTAAAACAGCTCCTTGCATCGGAACAGGTCTTTTAATTGATGTTGAAGGCTGTGTA
CCATCAAATGAGTGGTATACATTAAAAGCACTCACGCGTGCTACTGGCCGAAAAAGGGTAGGTAGGTCCTTGACTTCATGGTGTATTTGGCCCTCAGTTTGTGCTTTGTCATCAGATTTA
TCATCCATGATCTCCATAGAACTGACATCTCTCCCTTCTGAGGATTTCAAAGAAACATCCCCACATGATAGAGTGTCTTCCGATGATGCTTTTGCTTTCTCCAAGCTAACATCTTCCATG
AAGCTGACAGATTCTAATTTAATCGTATCATGACCAACTCCACGACGCCTCAGAGTGGAATTCCAGTGGTTCTTAATGGCATTATCTGTTCTTCCTGGTAGAAGCCTGGCAATGGCTGCC
CATTTGTTCCCATGGATTGCATGAGCAGCAACTATCATCCGGTCCTCCTCATCTGAAAAGAATTGAATTTTGTTAAGCCTACGTCTTTAGGAAAGTGGCATGATAAGATCTAATGTAGAA
ATGCATGCTGAGGTAGATTACCAACATATTTCAATGCGATGCATGTTTCTTGTACATCGGATTTATTATGCCTTGAGTCATAAGATAATGCAAACAGTTATAATTTGTTCCTGGTGAGCA
AATTTGCACAAATAAAAATAAAATAAAATTGTGCCTTATTTTTCTCTGCGGGTTGCAGAAAAGTCATCTGTGAGACAATAAATGGATAATAAGGAGATCTATCACAAGGGCACAAAAATG
TTTTAAAAAAAAATACTCTCTTCACAGTATTCTTATAATGATGACGATGATTGTTGTTGTTGCTGCGGTAGCAGGTGATTAGTATTGAAATAGAGGTACTTGGTACTTGAGTTTTTAGAG
AAAAAAAATTGGCAAAGATAGGCGTTAGCTATCAGTGGAAACGACAAAATTAGAAATTAAACACAAAGAGATAAGACACAAATGAAATCAGAGCAAATGCTCCCCCAAGCTAGAGAAAGG
TCCTCTGAGCTCCAAGTTATATTCCAATTCCATCATACCCCCACAATTGATTCCCAATTCCAATATAATAGAAACATTATTCAGGTTCTCTCTCCTCTAACAAACTCCCAATATTTCCCC
ACTAACAGACAATGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGGGCCTGTTGAGGCAATCCTGGGTAAAGACATTAATTCCACCATGAAGGTCCAGTACTTGCTATAAATCTAGGTTCTGATTA
GCCGGAGAAACCTGGAAGTCCAAGTGAAGGAGTGTGGCCTCCTCTACTGCTACACAATGCAAGAGGCCTTGTAATGCGGGTGAATGGTGGGCGTCTTTAATGTGANNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGGAGGATGGGGTATGCAGCCAACTCTCCTTCCAACCTGATGGTTTTGGATTGT
GCCAATTCCCCTGGGGCCAAAGCATGATAATCCAAAACTTGGCATGCCATATCCTGAACTTCAATTTTTGGAGTGTCATCGGAGCTAGGAACGGAATCGGAAAGGGGTGTAGGATCGTCG
GATTGATTGTCCTTCCCAGATTAGAAGACGATGGTGACGATCGAAACACAAATTGGTCGAGCCCCAATTGTTTCCACACTTAAAGCAAAGCCCCTCATTATGGCCCACCATGAGTTTTGG
GTAGGATAGATTACAGGTACCCGACCATGAAGAAGAGGGACCAGCATGGGTCGAAACAGATTTGGGTTCTCGGTCAACTAGCCCATTGGAACTATCCATAGATTGGGTTGGACTGCTAGG
CCCACTTGTCTAGGAACGTGGACTGCCAGAATTAGGCATACCGAAAAGGAAAAATCGTAGATGAGGGGTGGATTGACGCCAACCAGAAGTACCATCGTGAGAGGGCACGCGATTGGGGGA
AGTTCGAAGGTCAGCACCTCCATGCGAATATCCTCAGGTAAGCCAATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTTGACACATTTTGGCAAGTGATTATCATCCATAGCAAAGAATTCGTAGGAGGTGAGCATAGGAGTCGACTTGACTGAAGGGG
AAAAACGCGGCATATATTCACGCATCTCAGTGCACATGGAAGCAACATACTTCGAGAGTTCACTAACGCTGCTCAGTAAGGAACTCAACTAGGTGGATTGTTCTTTCATGACCTGATCGT
GAGACTAGAGAATGGATTCAATGGCAGTGACAATGCGAGACGTCATTCACATGTGCATATGCAAGGTGAGAATAAAAACTCAATGGAAGCACCAATGATAGGTGTTAGCTATCAGTGGAA
ACAACAAAATAAGAAAGTAAATGCTGAGAGGAATAAGACACAAATGAAATGAGAGCAAATGCTCCCCCTAGAGAAAGGTTCTCTGAGCTCTAAGTTCTATACCAATTCCATCATACCCCC
ACAATTGATTCCCAATCCCAATATAACAGAAACATTATTCAGGTTTTCTCTCCTCTAACTAACTCCCACTATTTCCCCACTAATAGACAATGACCTCAGGCCTTTATGGTTTTGGCCTAC
GAGAGTATCTCTGAAAAGGCCTATCCCATTTAGAATTCCTAATAGATTCTGTAATCTCATTCTTTCCCAAAGGCCATACTTCATATAATTCTTTTTGCTTTTGGTCTGTGGATTCTCATT
TTAGTTCATTGTAGCTAGAAACTGCAACTAAACTTTTAATGTCATGCACAGGTAGATATAAAATTAGCACAAGAAAGAGAGAACTAAATTTGAATGGTCAACAAACAAATGCAGTGCAAC
AGGAGAAGTAGAGACAGTTTGACAAATGGAATGAAATGTATTCATAATATCACATTCTTGATTATCATTGCAAACCAATATGAACAGTTATTTACATGATATAACCTATCCCAAGCATTG
AGCTTTTTCATCATCTAATAGTTTTTTTACCTCCAAAAAGGAAAGGTCTGTGAGATCAGTTGCTTTTTCACCACCTGTCAACCTCCATTTTATAATCTAAAATTTTGTGTATGCTATTTT
TAATTTTAGGAGTAACTGTGAGCAACACATAAGTATGTTCTATACTTCAAATTCACTACGCTTTGTTGATCATGATAACCGTATTCTATTGATGAATGTCCTTTCTGAACAGCAAACATA
TGACTACAAGAATACAGATCATCATCCCTCAAGTCAACAGTCAGACCTAAGATCAGTGTATAAAAATATAGATAGAAGTTGATAAAAGGAAACCCAACAGATGATGATATAAGAAACAAG
CAGTGATGTGAAGATGTTATAGTCGGTGCTTCCAAAAAGCAGTATGACAATTGAGACAGAATATTACTTGTGATGACAGAATTGAAATATCTAACTAACTAACCTAAATTAAATTAATAA
CAAGTCAAAGCTGAGATATGGTACTATAGGTATTGGTCATACTGTTCTTCTATCAAATTACCAAGGATCGTATTCATTTCAATAAGCACTGTCAACCTTCAATGCAGCCATCAATTTCAT
CTCAGCAACTAAAATAGGCATCTTCATAACCAGTGTAATACTTTTATTGGAGAAAAGTACTATCATTACCTATGTTACTGTACCAAAGTTTTGTCCTTAATAATATATTACACAATCTCA
TCCTAAAGCATATAATGAATGGAAGCCAACATACTTTGGGTATGTTTACAAAATGATAGGGATTCTCATCCATAGTGTATTTGGTTCCAAAAATATTTATCATTATATCATTATGAGTTC
AAATCTTGGAAATAGTCTCCCTGATTTCAAAGTCCCCAAACCCAACCAGGTGAGAGCACCATGCTGTTGTGCACTGAGATGCCCCATTTTATCTCAATTTTGGAGAAGAATTTATTTTGA
ATAAGCATTGGTCTTTTTTTTGTCTTTTTTAAAAGAGAGGTTCACCAATGATCTAGTGTCAGCAAGGAGAACGCAGGCTAAATATGAAGCAAATTGGCCTCAGTGGCTTTTGAATCCAGG
ATCAAGAAGTGATGAGGACTAGACAATACTTTGCTAACGTAGTAATAAAGTTAGTTGGGCAATTGAAATAGTTAAGAATAGAGACTTGGCCTAAATAGTAGGAGCAGGGAAGAAATCAGA
TTTGTTAGTTTTGGTAAGTGGGGAAGTAGCTTAGTGGTAAAAGGATAGCCCTGAAGGGGAATCTTTGGAAGAAGGACTATATCCTTTGGTCCGTGATTCAGTTAACCATTTCATAACTGT
TATTTCTCTCTTATCTAATGTTGTTCTCTTTCTAAAACCTAAGATGTTTTATGTTGTGTCTTTAACAATTTTAACCCAAATGCCAGATCCCTTATCAGGGATGACATGGAACATGGGATG
AAAGCTTGGAAGAACAAGAGGGAGTTCTTGAACAAAGAGAACCAATGGTCACAGGGTGCAATTACTTTCTCTGGCCTCTAATTCGCCCAAGATTCAGACAATTATGGTTGGTACTGAAGA
AATTCAACAATCAGTGGATAGGTGAATGAAGAAACCGAGCATAAGCTTCAAGGAGTAATAAGATCATGAACAACCCACTCACAAGACAAAAAAGTGAAGACTGAATATGGAGAAAACAGA
GTCATAACAGGAAGCCAATTATGAGTCCTTCTGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGAGAAAGAAGACATCGGATTTGATCTG
GGAAAATTTGACAGTGGCTATGGCTCAAAAGTTCCCAGGAAGAAGATTGTGCAGTTTGTATGAAAGATTACCAACCTTGCAGAAAATGGGTTTATTGATGAAAATAAACACAAGATTTTG
GAATCCTGGTGACACAGACAAAACACAGTGGGAAGGATGTAAAGTGTGGACATCATCTCATCTCAGTTCCCCAATTTCAAACTTATGGGCAAGCCGACAATGTTGAACTTTGAGCAGATG
GCATTGATAAGACCCAGAGAATTGCCAGTTAGAGTAGTTATAGAATTGGTTGGGCGACTAAAGCTGATTAGATTATGGACTTGGCTTAGGTAGAAGAGGAAGCATTCATATTCGTTAATT
CTGGAAAATCAATCAGCATATTCATTGTATGAGGCGAACCTTGGAAGAATGTTTCACTCCTTTGGTCTTCATTTATGAATCAGTAAACCATTAACAGAAGTGTTCCTTCTGTTATATCTA
TAAACTTTATCACCTTTAACAAGTAGTCTCCAAAGAAATTTGATACCACCTGAGCTAAGGCTCTTAGACATGTATTTATTTATTGATTTAACTTGATGGGATGTCATTTTAGCTAGCTCG
CTATACCTTATATATACAAGCAGTGAATTTGTCAAATACATTGCATTCTAAGAATTAGACTTCAAAAGGAAAATGGTTTAACAAGAAAAAAGAAAATAGGGATTAAACTGTCTGCAACCG
CATTAGTGGCTGCAATGTCAAGGTTTTTTGACACACCATGACTGCAGTAGCCACATTTTCCCACAATGTCGAGGATTGTGATGAAACCAAAACGGAAATCACAATTTAAAACCTAGGAGT
AACTAAAGAAATCTGAACATTTTAAGTTGGAACTAGACAAAAACAAATGAACAGCACTCAGGATCAAAAGACATTTTTTTAACTAATATTATAGATGGGATTCCAATGTTCAAAAAATAA
CAAAAACGAACCAGACACAAAACCAACTCGCTGCATGACAAGAGACTGTTATAGTATAGTGTATATCCATACTAGGTATGAACTTCACTTGAGAAAACATGAGAAAATTATGAACTTGAC
ATTTGGACTCACATGTTGCAGTATAGTAAGAGGACATCCAAAGGTCAGACTAAACCTATCCACAATAAGATCAGCCTCTCCTAATCCATGTGAGTCCTCTTGTAAAACGACAAAAACCCT
CATAGCCTGTGAGCATGATCAATCCAAACACACAGTAGCATACACCGCCATGACCATTTTAATTACAAGACACAAAGGGTCCTCTACTCAAACAACAACCACTGATATCAGTCAGCAAGT
AGTAGCCATACCCTATAGCCAATGATAACTACCAACCACCATCTCAACAACATCATCACCCTGGGTAACAACATGGTAATAATTCATAAAGTAACAGCTAGACAAAAAGGTATGACTTAT
CTACTAAGGAACAACAATGCACATAGCAAATTCAAAAACTGAACCACATAACCATAAACCATCAAACTTTAAAAACAAAAGAGCCTAAAATATAAAACATTACGATAAGTAAAATTCAAA
CCATTTCCGTTACTGCATTCTCATCCCTACTCTCCAAAGATCAATTTTCGAAAACATTCAAATTAAACCAAACCGAAACAAAACAAAATTCAATTCCAAACCGATTAGGTACCGGTGAAG
GGTTTGCGCTTGACGGCGGGGTCAAGCTGGTTGCACCACCGGAGCCGGCATGACTTGCCGGATCTTCCGCTGATTCCGCGCGCAATGAGGCTCCAATTTCTCGCGCCGAACTTGCCCACC
AGACGGCTTAGAATGGCGTCCTCCTCCGGCGACCACGGACCCTTTACTCTGTCCCTGCCGCCGCCGCCGCCGTCGTCTAGCCCGAGCAGCCCCTCGTCGAAGCTTCCGTCGGCGGCGGCG
GCGGTTTCTTCCGGTTCCATCTGTGAGGTTAGTTAAGAAGTGAAGAGTGGAAAAGGACAAGACAATAGAATAGTTAGCGCATATGTTCCGGCACTTTTTCAACACAAGCGTGTTCACAGC
GTAGGAAGAGGTTCAAGGCATATGTCCATGTGTCAACTGTTCAATTACAATTATACCCTCCCCCTCTCTCTCTTCCCTTACGTTTTATGAATATATTCTTGCTTAATTATGAATTTGATG
TCTTAATTTTTAAAAGATTTAATTTATTTCTCAAATTCTTAAAAATCAATCACTAACACGAGATTTTTATTTTTATTTTTCATTATGTTTCGTTTGGACTTGAACTTTATTCAACCCATA
ACTTTAAATAAGAATTTTTTATTCTACCAGTCTAGGATTTCACACTTTTGAAAGTTTAGAGATAGAAAGAAACTTTAGACGTGGTGACGACTTTGATGTGTTTGGATTCATCCTCCATTA
TTCCTCCATCAAAACCTTTTCCACCATAGCCATGAGTAACTAACTCTTCTTCGTTGGAATTTAATGTAAGTGCTCTAACTTTCATGTAATTTCTACATTGTTTCAATTTAATAAAGTATC
GTTATTGTTCTTTTTTCATTTTTAATGCTTGTTTTTGGCTTGATCAACTTATTTATATGATTTTATGATTCCAAGCGTAATTGGGAAATTTCTTTGGATTGCAAATTGAAGAAGACAACT
AATTTTCTTTATGCATAGGGATAAGGTAAAGAGAATTAGTTATCAATGAACTCTTTTTCTTAATGAAAAATATTTAGTTAAGCTAACTCAAGGGATTGATAGTATAATCAAGGCATTTAA
GTCTTCTAGCTTAAAGAATTTGAAGTGACAAAAATACCACAAGAAGGGGGATTGAATTGGGGTTCTACAAATTTTTTAAATCCCTTATGAAAATATTCAAGTTTTTTTATGTAAGTTTAG
AATTAAGAACTATTATGAGCTCAAAACGAAAATGCAAGCAGTTATGAAAAACACAAGTTCTTTCATAGTTTAGAGCTTTGTTTAAAAAAAAGGTTGTTTATTTGAAAAGACTTTAATAAA
CTTATTTCAGTTTTATAAGTATTTGTGAAAGGTTTATCTATTTTAAAGATTAACAACACAAGTAAATAAATTTGTTCAAAATTAGTGCAAGCAGAGGCGAAAAGAATAGTGCACAGTGTT
TTTTATACTGATTCACCCCAACATTGGGCTACGTCCAATACTCATCCTTGAAGATGAGGTTTCACTAACACAACTAGCCATTACTAGACCAACAACCATTGGATTTGAACAACCTACTAG
TACTCCCACTTGACTTCAAACTTAGCCTTTACTAGACCAGCAACATCACTAGATTTCAACCTTGCTCGCCACTACTGGACTTATAACAACAAAAGGGTTCTTGTATTTTAGACTGCAAAG
ACACAAATTTTCATGTTGCAAATGGTTTTCACTTAGGAAAATACAATGTCTAACTTCTATTTAGTATTTGTAACAAATTACAAGCACAATACATTAGTGGGTCACTCTCAACAAAGAGGG
TTGAACCAAAAAATGAAAATTTCTCATACATAGATTAAGTATACATTTCTCTCATTGGAAAATGCTTCAACTTCACTTCAAGATGTTCTTCAATAAACTCTTAAAGCTCCAAAGATGATC
GTTCAAGTGGAGCTCATACAACTGATAGGTTTCTGGAGCAAGTAAACAGTCATGAGTTGTCATGAAATGACAATTTGTAGAACCATTCTGAGGAAGTCATTCTAAGGTTTCCATTCTGAG
GAACCTTTCTAATGAGCATTTTAACTTATCATCAGAATAGTCATTCTAATGTTTGCTAAGAAAGAATCCATAGTTGTTGTAGATTCTTTTGAGGAAGTTCAACTGATATGCCTTTTTGAA
GAAGCACAACTTCATCAGTTTTAACACATCTTCCCAGCACAAAGCATCCTAAAGAAGATTGTTGGTGTATTAGTGTTCATCCAACGTCAGATTGTGCAATTTCTTCAGTCTTATATACTA
ATGCTTCTCATAAGTGCTTCTCATGGACAGATTTAGCTTTCAACATGTTTGCATCTTCAAAAAATGTTATTAGCATTCACTTTCTAATGTGTTCTCAGTGTGTATTGCAACATATGGAAA
ATGAAGTGTTGTTAACTTCGGTCTTCTGATGTGCCTTTTGTATTTATTGCACCATATTGAAGTTATGAAGTTGTCCTTGAATAACATTTTAAACCATTTTGAACTTCATTCTAAAGTTCT
GTTCTTCAGAGTTAGATTCTTCATCATTCTAATGTAAACTCTAGTACAACTTCATTCTGGTTTTGGATATGTAACTTTCAATGAGTCTTCTTTGTAAAGCCTTGTTGTTTGGTTCCTTGC
CAAAAAACCAAGTTCTCAAAGGGAAGCATTCTTCATCATGTAGATGGACTTCAAGAAATCTTTTGAGTTCTCAACTTCTGACAACTGTTCTAAGACAACATTTCTAAGTATCATTCTAAG
GACTTCTAAACGAATGAACATATTTTCTTCTTAAGACATTTAAGACTAAAACACTTAAGTAAAATGTTAGATGACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTAGCAAATTTAAAGGGTGACAAAACCTTTATGAATTTCTTAAATTTTAACTCCCCCT
GGGAGTGTGCATCAATTCTATTTCATTTTAATTAAAGGGAATCTCCCCCCTTAATTAATGCGTTATTAACTTAAAATGACAAATCTTTCATAGCATAATATAATGCAGAAGGAAAAGGAA
TTAAATGAACACAAAAAGAAATAGTCATTTAATCATATCAGTTTCATTAATAAATAGGATCATACAAAAAACATCAAAAATATATAAAAAGAAGAAAAAGATAATGGTTATACAAAATTT
GATCCCCTTCCTACTTAATCTCTCCTAAAATTCTCCCCATTTGTCATCAAGCAAAAAAAAAAAACAAAAGAGGAACAAAGGGTGTAGATCAATCAAACTTGTTACAAGAGGAGTTTTCTA
AAGATGAAGGCATGGTGGTAATATTGGTGGTGGTGGAGGTTTATGCTGCATAGGGGCAACTTTAGGGATCAAGGAAGGTCTAGCCTTGTCAGAGATCCACTCCTCAAGGTGAAGGAACCT
CTGAAAGAACTCATTAGTCCTCTAAAGTTGGTCAATGTTAGAGAACAACAACTTTTGGTCAGAATGAATCTTCCTGACTTGCTTCTCCAAAGCTTACTTTCTGCTAACCTTGAAGAAGGT
CCAACAATAGGTGAAGGAGAGGAAATATGAACAGGTGAGACCTCTTCCCGAACATTAAAAGGTTCTACAGTAGATGAGTCAAACGGGGAAATGGAATGGAAAAGGTTGAGGGTTCACCAT
GTATGGGACCAAGGCCATAGGCAATCTTAACAGAAGTGTCAAAGATGGAAGAGTTAAAGAGATATTGTAGGTTTTCAATGTTGAACGTAGAATCCTTCATAGACTCAACATGGGTCCTTT
CACCAACTTCAACTTCTGGTGTATTTTGGATAATAGCAGCAACAACTTCAACCTTTTCTGTGTTCTCAAAAGACTTTTCCTTCTTGTCTTCCTCATTCTCGGTGTTTTCCTTCTCCAAGT
TGGAATTGATAGTCCTTAGCTTTGTTAGCACATCAGAAATGATCTCCGCTCATCAGATTTATAGGATGTGAAGAAACAAATCTCCAGCTTTTAGGCATATCAATTTCTGCTATCTGTTAT
GAACTTTGCCTTTTTTAGCCTTTCTGAGGTGTCTTAGAAGGTTCTTCTTCAATTTTCTTGGGGCTTTTTGAGGTAGGTACAATGTTCTGAGAATGTTGGTTAGACGTTTTTCTTTCCAAC
TCTTCCAAATTTGCAATCCTTTTCTTCTCAAGTGTGTTCTCACGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAGCTGAATTTG
TTTTCTTTTTGTGCATACCATATTCATTAAGAGGCGCATCATAATCATAGCTTGTAGCAATAAAGGGACAACTAATAGTTCAACCAAAATTTGTTTCCCCATGATACTGGAATGAAAAAA
ACAAAAGGGCTTAATTGGCTAAAAATGGGTAAATAAAATCCACGCATTTAAATCAACAAATGTTGAAGATACCATATAATAATTGACAGATGATCCCCCTTTCTGTATAAACCTTGCAAT
TGAAAATGCTAAGTCCTCAGCAGGTGTGTGAGGAACTACACCTCCAAACTCAGTAAACCTACAAATTTTAAAAAATAACACATGCAATGAGCAATCAAGAAAAACCTCTAGCTTTTATGA
TTTTCATTCGTTCACAAACCTAAGAAGTAACAAGGCACCAAATACAAGCTAAAAATTTATTGTACAAGCTAGTCCAAGCTTATGTCCACATCCTTGGTTTGTAAGCCTTATTTGGAGAGA
AATAATCACAATAGAAGCCATTGCAAGTGTTAATTTGCAAAATTTTATATTGGAATTAGGAGTTGGACTTTGACCTTGATTGGAAAATTTGGATTTACATGCATTCATGCAAATAATATT
TTTTTGAGTATATAAAACTATTTTAAATTAGTGTAATTTCAATACAATTATAATAGTCAATTGTCGGTCATGATAATGAGAACAATATTGAAAGGACTGAACAAGGACAAATCTCAACCA
TGAACAATGAGGAATAATTATTCATTTCCTCCATTAGCAATATTGACAAAACATATTGTCCTGGTATCTCCACCAAAGACAACAAGCTATTATAAATATTAAAGAACATGTCTATAAATG
GTATGAATAATCTAAACTTGCAATAGGATCAGAAACATTGTCTTGCACATGATCCATGGAAGCACCAATTTCATACTCCATAGGCCCACATTCATTTTCAATATGAACAAAACATAATGT
TTTCTATGTATATATCCATTTTTAGTCTATGATAATAAGGTTATAATTGTTTTCAAATTAAAATTTTCAAATGCTACTTGAAGATATATAACAAGCGATTGGATTTTGCACAAGGATAGT
TATATATGTAATCTACCTGGGACAAAATTATTGGACCGTCCTGAGACTCGAATAACCTTTCTGCTTTCATCATATCTACAATCTTCTTAGTAAACTTTTCCATTTGAAACTTCAACACAA
CAACATTAGAAGAAGAAAAAAAAAGGATATTAGTAGACAAATTAATAACATAAAATATATATAAAAAAGAGAGGAAAATTCCATATGATTCTTAAAAGGAATAAGAAATAGTGTTATCTC
ACCTTAAATGGTCCATTGTCTATTCTGAAACTGATACTTGGAATGTACTTGAGCCAAACAGGGAAACCTCTGAAAAATGAATAACATTGCATTGTTGAGAAAACTAAATAATCATGATTC
GAACAATTGAAACAATAAATTTAAAAGCATAGTTCAAAAAGCTCAAGGAAAAGCATACTATTGGGAAGTTTTTTAATAGGTCCCTCTAGTTTAAAATCTATAAATAGATCGCTATAAATA
GGTCCCTCTAGTATAGGGATAAGCATATGATAATAGTATCATTCCTCGTGTTACTTGTGCAGCTAGCAGCGATCATAATTTAAAATTATTGAAATATTCGAACCAAGTGATAACCAAGAA
ATCAAGCACATTGTTTAGCACCATATATGACCATAGTGATTATTAACATAAATTAAGAATCTGGTTTGAAAAATGAACTCTTAAGCCTGATTTTATACCCTTGTGCACCACAAGCCAGCT
TCAATAGAGATCAAAATCACCTTGAACCATATTCATAACTCAGAATATTACAGAGGAGAAAAAAATTAACAATACTACTTACAAATAAACTTATCAATACTTTAAAAAATTTCAGAAAGT
AAAAAAAATGAATTCTTCCATACACATATATAGACTCCCTCTTCCACTTGCCAGTGAGAATAATGTCAAGACAAATAATGAAGAAACTATAGTAAGTGATGCTCTTTTTCGACTGATGAT
AGAACTGCAGATGGCATGCTCATGGCCAGTGATAAACATATTTTGTTTTTGGATCCACATTGTGACCTTTTCCTCCATTCACTTCTAAGTCATGCCTATGAGAATAAAAGACAAAAAAGA
ATTAGAACGTATAATCTAAAGTATATTTACTTCAAGTCTCCNNNNNNNNNNNNNNNNNNNNNNNAATAAGTTTAAACTAGAGTGTGTTACCCATGTAATAGCATTATAAAAAGGAACAAA
TGATTATAACACACAAAAACATAGACTCAACTGAAAGACGAAATCTAGGATGGTAAATTATTCACAAGGTACATATCTGAAGAGTTGTAGTAGTCTATCAACATATACCACTTTGTTCCA
AACCTAAAAGTTAATCATCAATGATAATAACATGTAGAAGATGTCCTTAAATAGGTTTTAATCTATTAATAAAATCTGATTCATAACGCACCAAATTGTCGACAAGCAATTGAAGTGCCA
ATACTGTCAATTTTAGTCTAAGGGTTGGGTGGAGGACATATATTTCCTGTACATAAGATGAGATTTGAGAGATGAGAACAAAGACTACAAAGGCATAACAATAATACATTTAAGAAAACA
TAAATGTTGCATACATGTAGGTTGTGCAGGTGCTTCCATCCAAGTATTGATTGTAATCTTTTCATCCAACCTAGGTCTGGTTTCTTATTTATACAAAAATAAGGTAGAGAAAGGTGAATG
AGAATCATCAAGAAACCATACTATTAAACATTGCATACAATTCTAGAGCAACCAATGATAGGAGTTAATTGAGTTAAAACAATAAACATTGTGGTTGACTAACCCCTTCAACTAGACCTA
ACCTTTCGGTGGTTGCAAATGAGTTAATTGAATTAAAACAACAAACATTGTGGTTGACTAGCCCCTTCAACAGCTAGGCATACAACTATATATTGATCATTCTTGTCCCCTCTCGTTTCC
TCAAATTTCATTTCATTGAATACATGGTCTTTGGCATATGACCACTCGATAGAGCTCACAATTTTAATTTTTACTGAACATTTACTGTTAGATATCATTGTTATCTAATCTACATTGTCT
CATGTGAATCTATGACATAACAAAGGACATGATCACCTCCCAAATCAAAATCAAAGACACAAACACAAAAATTACAAATTGCCACCAAGGATTGAACCATTAAATAGTGTAATTAAAAAG
CAAACGACCACAAATCCAGATATTAACATGTTTTGGGTTTAGGGCCTTCAACAACATACATGTTAGGAAGGTGACACTAGGGCTACCATGCAAGAAGTTAACACAAAAAAAGAAAAAGAA
ACTAAATATTAATTGTCATAATTTTCCATGTCCCTTACAAATGAGAATTGTGCACTAAATAGACAAAAGATAACAGTCCTAATATATTGTCCATACACATGGCAAGATCTACTAGCATAA
AAGATTATTCTAAACATCAACCACAATACTCAATCAATCTAAAACAATAGTGTACAATAGGAGATGCAACCATCTAACGTATATTCTACTATAAACACTACTAATTCACTATGATATACA
CTAACTCTATTGCAAAAGCTAATTTCTGAAGTGAGAATTTTTTCTCTCACTATATATATTATTTTCATCGTACCATTAATTAAGGTTAATTTTAAACCTAAATACTAGCTATTCTAACAT
CCTAAAAAAACAAATGGGAGCTCAAAATAAGAAATTTTATTAATTAAATATCATCTTATAATATTACATTGGAAGAACATACCCAGACTCATATAACCAAAGAACAAGAAGGCGAAGAAC
AACAATAATAACTCCTTAATAGAAGCATTAACAGTAGTTTCTAAAAGTCCCCCCTTCAATTCTCCTAGCACAACCTCTGCTATTTTAATAGATAAACCCACTTGGTGATTCAAAATTGAT
CATGAGATGATACACAACAAAATTAAAAAGCAGGATGATCTATTGATCTCATCTAATATAATAGAAAAGTAAAAAAACAAACATGTGCCTCTTTGGTGCTAGCATAAAAGGGGTAAAGGT
GATATTCTCGTGTTGCATTCACTTACTGTCTTTGGATGGGGGCTCCTTGATGAAGCCATCAAGAGCATATTATTCCATATGCAATTGTGACAAAGTTATAGTAATTTTAATATGCAACAT
TAATTGGAGAGACTTGTTGAAAACTGAAAGAAGAAAAAAAGGGGTTGACCTGAGCAATGGTTCCACTGTCGAGTGCTCTTACTAATGCATCTTCGTCAATAACACCTTCTCTTGCAACGT
TGATAATGCAAACACCCTTATTCATCTTTGCAAAAGTGTTTTCATTAAAGATCTTGTTAGTAGTTGGAGTGAGTGGCATGTAGAGGGAGATGAAATCTGCAGTGGCGATGGCTTGATCAA
AGGACACCAGATCCACACCAAAAGCACATGCACTATCACTCGGAGCATAGAGGTCATGAGCAATCATGTGCATGACCAACCCTTTTGCTCGCCTTGCCACTTTTGATCTAACTTTTCCAA
AACCCATCACCGCCAATGTCTTTCCAACCATGGAAACTCCCACATACTGGCTTCTCTTCCATTTTCCTGCAAAATTACCATCAGGCCTCAACAGCTCTTCTCGAGCAACATGAATTAAAA
AAAAACAAAGATGGAAATTACTAGCTTTAGTGGAGGCGTCAGCTTGGGAAACGTTGCGGACCATGGTAGCAAGGAGAGTGATCCCATGCTCGGTAGTAATAATAGTGTTTGCAGTTGGCA
CATTATCCAACAGTGTGGGCCCCACTGAGGGTGACAAATTCTTCCACAGTGAGGCTGTGTTGGTGAAGAGTTGGGTGATTTGGGAGATGGGCATGGAATGGGTGGGGAGGTGGAAAGATA
CGACAAAGGCGAGTAGGTTCGGCCATTGCGATAGCCAAGGAAGACGAGGAAGAAGGGGCCACCGAGCATGGAGAAGAGGTTGCCGGTGGCGACAAAGAGGATGTCAGAGGTTGGGGCATA
AGAGTTCAATGGCGATCTTGGTGCAGATGATGAGGTTGAAGGCGTCTTTGGGGAGGGAAAGACCCACGCCATCAAGGAGATTTGCACGCAAAAATAGGGTTGTTAAAGACCTTAACTTTG
CTTTCTCTTGATAAAAAGAGTCAAATGGGTGTCTCTATGGCTTTTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNAACATTGATTTTCATTAGAACCGATGTTAAATCCATATTTTATAGTAGAGTCGGACAAGAAAATTTGTGGAAGATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGGCTTCCAGATAGAATTAACTAGGTAAGGACTATAGACAAATCCTATAAAGGTTTCTCTTTC
TCACACCTAAGAATAGGATTTTTCCAATAGACGCTTATTTAATCAAACAAACATGAGTTCAAACTTAACTTCATAGCCATTGTCACAAAGCTGACAAACTTTATTTTGATTTTCAAGTTG
AGTTTGATCAAAAGTGACAACTCCTTTTGTAGTTGTCTTTATTCTTAGTTTTAACTGTTCAAAAAGCTTGAAATGAGATTCCTACAAACCGTGGTTTCTTTTAAACATATTTTCATGATC
CATTATGAGCTTCTCATTTTCTTTCTGAGCATTAGAAAGTTGCTTCTTTAAATGATCATATTTCTAAGTTAAAATATGAGAGTTATTGAGTAAATTATCATAAGATTGTTCTAACACTTT
ATGATTAGAGAAATCTAAGACACTTTCAGAATAAGATATGTCTACCTTGTTAGAGTCTGCCATGAGATGCAGGTTGGCTGCATGTTCCTTATCTTTCTCAAAGATGATGAGTTTGTGTCA
TCCCATGCAGCCATCATTGCATTCTTCTTTGGATCTCGTCTCTTGAAGTCTTTCTTAAGAAAACGAGAGTTAGTTTGGATGTGGCCAGGTTTGTTACATTCATAACATCTTGCTTGCTTA
GAGCTTTCTCCTAATTAAAAGTCTCTTCTAAAGAAATTCCTTCTTGGCCATTTTCTCCTTCTGAGGAACCTCTGGACTCTTTTGGTTAGAAAAGCTAGTTCTTCTTCATCTTCCTCAAAA
AACTCATTATCACTATTCTCATCATTAGAAGTTGCTAACGAGTTTAGTGCTTTGGGTTGATGCTTTGTCTTAGTTTTTTGAAAGGCCTTGAGAGCTATGTCTTTTTCTTTAGGTAGTTGT
AGTTCATCTATCAGCCTTGTTCATGAACCTTTAAGGAGCCAATAAGTTCATCTATAGCTAGATTTCTCAAGTTCTTGGCTTCTTTATAGTAGTGACTTTAAGGAGCCAATAACTCTTTTT
GATTCTCTTATGTGTTGTGTGCTTTTCTCCAAGAGCATTTAGTTTATTTAATATAGTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTATTATGTCATACTCAAGGAA
CATGTCAAAAAGAACTCTGCTTTAAAGATCAAAAGAACTCTTGCTTTTTCATCCGAGGTTCACCACTCTTTAGGTTTGTCTATTTCAACTCTAACTTAATTTCTTTTTGTTGGTTTGTAG
GGACAAATCTATATAATGTCCCACGTATCCACATCCAAAGATTCCAGGAACAACTTTGTTCTACCTTTCTAGTAGTAGAACTCTTTTCAATCAAATCCAGAAGGCATGTTGGTTGAAGCA
CCTTCAGGTCTAAACACTGTTGAAGCTTGTCTAGCCATCACTTCTTCCATGATCTTGCTCTCACACTGTCAAGTGTGCTTAACCCTGTTAAGCTCTGATGCCAATTAAAGTGATATAAAT
ACTAGAAAAGAGGGGTTGGATTGGGGTTTTACAAACATTTTAAGTCCTTTATCCATGTTTCTTATATAAGTTCAAAATAAGATAGTTCAAAATGAAGAATTGTTATGAGCATAGAACGAA
AATGTAAGCAGTTTGAGAAAAACAAGTTCTTTCACAACTCAAAGCTCTTGTGTAAAAAAGGGTTGTTTATTTGAAAAGGCTTAAATAAACTTAATTTAGTTTTATGTGTATTTGTGAAAG
GTTTGTATATTTTAAATATTTACAAAACAAGTAAACAAATTTGTTCAAAATTAGTGCAAGGAGAGGGAAGAAGAACAATGAATAATGATTTTTATACTAATTCACCTCAACCTTGAGCTA
CATCCAGTACTCACCCTTCAAGATGAGATTTCACTAACACAACCAACCATTGTTGGACCAATAATCACTAAATTTCAACAACCTGCTAGTACTCCCACTGAACTTTAAACCTAGCCTCAA
TTAAACCAACAACACCACTAGGTTTCAACCTTGCCAACCATTACTGGACTTACAACAACAAAGGGTTTTTTGTATTTTAGATTGCACAAACAAAAATTTCAACTCATAGAGGGTTTCCAC
GCAGAAAAATATAGTCTCTCACTTCTAACTAGGATCTATTATAGATTACAATCTCGATACATGAGTGCATCACTCTCAAGAGAGAGTTGAAGCATAAAATGCAAACTTTTCACACAAAGA
TTAAGCACATGTTTCTCTCACAGGAAAATGCTTCAACTTCACTTTAGATGTTATTCAATAAACTCTTAAAGCTCCAAAGATGACTGTTAAAGTGGAGTTCACTCAACTGATATATTTTTA
GAGCAATAGACAGTCATGACAGTTGTCATGACATGACAAATTGTAGAACCATTCTGAGGAAGTCATTCCAAGGTTCCCATTATAAGGATTCTTTCTTATGAGCATTCTGACATATAATTA
TAATAGTCATTCTAATGTTTGCTAAGAAAGAATCCATGCTTGTAGAAAATTATTTTAATGAATTTTAACTGATATGTTTTTCTGAAGAAGCACAACTTCATCAATCTTAAAACATCTTCC
CAGCACAAAGCATTTATGAAGAAGATTACTTCATAGATACCGAGTGAAGGTATAGTTATTGGTGTGTTGGTATTCTGTCCAAGGTTAGATTGTGTAATTTCTTTAGTCTTCTATGTTGAT
GCTTTTCATTAGTATTTCTCATGGACAAATTTAGGTTTCAATAAGTTTGCATCTTCAAATGTTGTTAGTATTCGCTTTTTGATGTGCCCTCAATGTGTGTGACAACATGTGGAAAGTGAG
TGCTATCAACTTCAATCTTCTGATGTAATTTATGTATTTATGGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTCATTCTGAGGTAGAGTCTGGTACAACTTCATTCTGATTCTGGATACTCTTCATGCAACTTTCAATATGTCTTCTTTG
TAAATTCTTGTTGTTCAGTTCCTTTCCAAAAACCAAGTACTCAGAGAGAAGCATTTTTCATCATGAAATTTGGGTTCAAGAAATCTTTTGAGTTCTCAACTCTTGACAACTATTTTGAGA
CAATCTTTCTGATCATCATTATGAAAACTTCAAAATGAATGAACATAGCTTCTTCTTAAGACATTTAACATTGAGACACTTAAGCAAAATGTTAGTCAACACTTAAACCCATCATCCTTT
CAATTTGCATTACTAATGATTTGTCATAATTAAAACCAGGGATGTGGATTCAACAGAATTAAGGTTAGGATAAAATTGTGAGTTAATGATAGCATAAGCTTAATTGTATAGAAATACATA
ATGATTGCATGTTAGGAAGTCCAATGAAGTTACACCCCAACACTTTCTCTCATTGAATTCATCTCATTTTTCTATATACACCAAATGCTCGATAAAATTCCTTAACCCTTTTTTCTTATT
TTTCTCTTTTAATTTCAATGCAATTGTCATTTAATTTGGTTACTTGATTCTTCAATATTTGTACTCTATAAATTCTACTACTAATTACCCAATTATCGCACAAATCCCTATAGAGGCAAT
ACTTTTCTTATCCCTTTGTTACTTGAGAGATTTCTTACTCTTGCCAAAATCCCAACACCCTTTCTTAAGGATGTATTATGCAAGAATCTAGCTTAGATCTTCTCTCACAATCTCAAAGCG
TGTTGTCAACCGAACTGCATCTATTGGATACTTTTTAAATTTGATACCATATTCAGCATTCAGCTAGTTCCTGGAACGATCATCAGTGCAAAACTTTTCCTATTGAGTTCTAATGTAACT
ACATTTTAAGAACTCTTTAACAATTGATTGACGTGTTTCATCGTATAAAATGAGAAGCATTAATCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNGTGTAAAATTATACACTTTCTTACCACTATTACTCTAACATATCACTAAAATGACTTGATAGTGTATGTAAGTGTGTACCAAATATATATTTTTTTCAACCATTGTAGTTAG
GACTTTTGGTTCCCCGGTGGAACCTCAAGGTATGTGTATCAAGTATATAACTTAATTAATCATGACTTAAATATGTTTTTGGTTTCTGAAAAGTTATAGAATTTTGCATTTGGCTCCTAG
TAAATTTCTTTCTTTGAATTTAAGTCCTAAAAAAATTATTTTGCATTATATTTAGTCCATATCGTTACATTAATTCTGATAAAAAAACATACTGATAGTTGTGGTAAAAAAACAATCAGG
GACCAAAAGAAAAATTCAAAAATATTTTAAGAACCACTTTATAGAGGCAAGGTAATTGCAAGGATGAAATACCCAATAAAAAAACTTTTAAGGACCAAATGCAAAGAAAATTTTATTAGG
GAACAAATGCGAAGTCCAACAATTTTTTAGTGACAAAAAACCTATTTAAGTCATTAATCATTTGTCTTAAAATTATCAAAGAAAACTTATTTAAATTTTCATGATGTACTTTTTCACCTC
TACTTCCCATGCATGTCTTTTATTCCCTAGCTCTCATTACTACCTGCATAACAAAGGTCGTGTCAGGATGGCGTAAAAAATGACAAGATTAAAANNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTTACATAACTTTAAATTTATTTAACAAAACTATTATTATTTTCATTACAAAATGAAAAAGAGTAAATTACATAAACCTTTCTTCAGA
TTTCAAGAAATTACACTTACATCCTTTTTGTTTTGACATATTACTTTAACCCCTTTCCTTCAAATGGTGTTAACTAACAAATACTCNNNNNNNNNNNNNNNNNNNNNNNCCTCTTATTTT
GTGTGAGAACCCCTCCTTCATTCGTTAAAATGGCTTGGCCTGAATCTTCACAACACTTTTCTCATTCTGCAGCTATAGAATCATCGTCTCATAACCCTTTTCCTCTCCTTCACTTTATAT
TTCTTCAACCCTCTCCTCCAAAACACAAAGCCACCTTCCACACTCTGCCACAACCAGCAAGCCACCACACAACCAAAACACTTTGTTGCCTCTGCCCAAATTATTGCCACTATGATGGCC
TAACCACTCTATGTTTTTGTATGACAGGATTAGGACTTTCCATATTTGTGATTCATAACTCAATATGACCGTTAAACATAAAAGAGGAAATAAAAGATAGACTCGCAGATATGTTCCCAA
TTTTCCATGTGTGTAGTAGACAATGTTATTGCTTTGTCGTGCGATCGGGTAGTGCTTTTAGACTGTTGAAATGGTAAAAAAAATGAGATGTTACCATAGGATACCTAGGTATGGTTAAAA
TCTTAAGTTTTTAAGCTAATGTCTAGAAAGAATAAAGATAATTTAGAGAAAAGTTTTTGGTAAAATAATGGTCAACTCATTAATGACCTAGATGTTAATAATTGGATTTTGGTCAAGAAA
TAGAAATTAGAAGCTTGAAAGAAAATTAGTAACTAATGTAAGTAAAGTTAGAAATTAAGTGAGGATAGCTAAGTTGATTAATGGTGATCTAGATTCTATGGACTCAGAAAAGAAGTAATT
AAGTCATAAGAGTTTAAAGTGGAGGGCACTTTCATAAATGACTATATAACTAGTTTAAAAATAGAATTTTAGTTTAATTAGTGGGTGACTAGTTAAAGTGTCTAATTATATGATGTAGAA
TAATTAAAATAAGTTAGAGTTGTAACACCCTGAAAAATTACAACTCAGACTAACAAAGGAAACTCTGTGTTGTGTCATTTGTGCATGTATGAATTTAATTTCATTAATTATATGTTTTTA
ATCAGATAATTTCATGTTGTGTGTGTGTATGCATGTGATTGATTTAGTAAAGCTTGAAAGAGAAATAAAAACTATCTAACCTAGATTTCCCTCTGTGCAATAATTGCACTACGCATTGAA
TCCCAGCATAATTTGTCTCTACGTGAGTGGACTTTGTGCAAGGTTCACTCTGAGTACACATATCCCAAGGGAGGTTAGCATACTAGTCTAGGAAGTTAGCACATTAATCTAGAAGATTAG
GATAAGATTTACCAATTTTAGCAAAAGCAATTTTTTCCATTTTTATAGTTAGTTTTGAAAAAGTGCAAGAAGCCATATAAGGCATGGCTGAGCTTGTGGAGAGAACCTCAAGGGCTGTCC
AAGCTGTCAATTATTCATATTAATGGTCATTCAAAGTGCTTAAATTAAGAATATAAGGATGAGGCCTTGCAATCCCATTGGTCAAAGCATTTCACCTACAATAAGTGTTGTTTTTTTTTT
TAAAAGCCTAAGCCTAGGCTAGTTCTCCTATTTTGTTGAAGCTTTTGGAGAAAGAGGAGACAATATTTTTCTTCTTCTTTCAAGTTTTACCAAGTGTTCTTGAGCCATTCTTCCATGAAG
CTTAGGTAAGTGACCTCCATTTTCAACTCTATGCTAGATTTTCACTTCATTTTCTTACTCTATTCTCACTTGTAGTTTCAAAACCTTATTTTGCACTCTTAAAGGTTGGAAACTTGAATC
CAAACTCAATCATTCTTCCTTCTAAATTTCGTGGAGATTACCAGAGTTAAGGGGGGGGGGGGGGGGTCTCTCCAACTCTTGCACCATATGCTTGTTGTTGAACTTCCTTGAACATATTTT
TGCTTCAAAATTTTTGAGCTTGCTGTCATGTCCTGAATCTGTGTGTTGAGTTGTTTTCCTTAAGTTTTGATGATAAAAATAAGTTCCTTGCATGTTAATACATAGAGTTAGCCTAAAATT
TCACCCAAATCGGAGTTTCCTAGCAAAAGTTACAAATAAAACAAGTTTAAGGACTTTTAGTAAAATGAAAAATCTATCACGAATTTGGACGGAGAGTTATAGCAGTATGGACTATTTTTT
ATTAAAGTTTTCACCTCAAAAAATGAGTTTTTTAGGTTTGAAAATGTAGGTAGCATATAAGATTTGTGAAAATCCCACTCCCGGAACACTAAGAGCACTAAAAATGAGTTAGGAACAAAA
CTTTAAAAAATTGACCGACAAAGTGATGTTAGACAGTATATAGCTTAACTTTGGAATCCATCCCTTTGTATAAATCATATTAGAATTGTTTACTTTTAGGATCTTCTTATTTATTTTCTA
ATATATGGTTGAGATATCTGCAAGATCTAATGACCGATGCATGCTTTGAAGTTGTGATGATTCTCTGCTGATAAAATTACTAAAATGCTTGTTTGTATTATATTATGATTATTGAATGAT
AAGACCGATAGAGTATGAACTCCGACAATTATATATATGGCATGCGAATTTATTTTATAATATATGGNNNNNNNNNNNNNNNNNNNNNNCTAATATTTTCATTTTTTTGGGGAAAATGTA
AATTATATTAAACCCAAAATGATACAACAATACATGTGACATACCCCGCAGCTAGAGAAAAGCAAAAACCTCCCTAATACAAGAAGGCCTAGATGAAGATGCTAAAACAAATGCAACAGG
TGCGCTTGTCTATACATAAAAAAATTAATCTTGCTAATAACCTCTATTACAGAAAATTGATAATCTTCAAAAATCAGCTTGTTCCTAGACAACCAGATGTAGTAGATTGTAATTGTTATA
GCTAGGCAACGAAATTTTCCTTGAACACCTGATGTGGATCTGCCCCTAATTAAAGAGTCAGTAATGCGTTGCAAAGAAGTGAAACGCCTACGGAAAGGAGCCAAATCACGAATGTGAGCC
CAAACTTGGAGAGATTTCCTACAAGAAAAGAACAAATGAGCATTTGACTCAACCTCATTTGAACATAAAGGGCAGAGGGAACCCTTGTTCAAAAAAACAACTTTGTCAAGAGTAAGCAGG
CGGTTCCTTTTAGCAATATTTTCATTTTTATCTGTATGTGTTGTGGTTTGGATTCGGGGGTGTTCAACCCTCGGCAAATTGTTTGTTATGCTTGTTTAGATAGCTATGATTACAATCGTT
GTTATTCGATTATTCTGTGTGACAAGTGGTTTTACCGCTTAAGGGGCCACAACTGCTTCTTTGAGAGGCTTGATTCTCGTCTCTCTTTCTTTGTTGTTTGTATGCGTCCTTTGATGCATG
TGGCACGAGGACTACGCATGCGATGCAACGACAACAATCAAGAGGATTGGATAGAGATTAAAGAACCATTGGTTCTATTTTCTTTTGTGAGAAGGTGAGGTTATGTTCAGGAAATGGATG
ATAGATAGAGATACACTAGGGTATAGTGGGTGGAGAGTTTCGAGGAACTTAGGAGAATTAGCGAGTGGTGACTACTCGACATTTTGTGCACTCATTTGATAAGAGTAACTCACATGCCTA
ACTTTGCTACTCGTGACAGGCTCCAAGACTAAGGGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTAAAATTTTAAAACAAGTAAATTTAAAAATCCAAGACATTTAAATGAAAATTATATGTTTTTTTANNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATTTAAATGAAACCCGATGTTGTTTTCTATTCACCAACATTTCTTAGA
CTAATATAGTTTTTTTTATGTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTTCTTAGTTTATCTTATGAAAACGTCGGATGTTGTGT
GCTCATATGTTGCATAATTGCCAAGACAAAAGCATGTAACTCATAGTAAATGGCCTAGCTGGCAACATGATCAACATCAAACATAATCCAGCACAACATTTAGATGAAAGTCCTTATTAA
TGAAACTTCCCTCTATAATTGTAGGAAAGAGAATAGTGTTGGATGAGCTGGCATGGCCAAAATTAAAAATTTGTTGTTGCAGCTACTTTGAACGATCACCAGAAGGGTCCTCAAGAGCTC
TCTTCTCGTCATGACATTTCTTCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTGGGGGGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTACTTATGGTTTTTTGTCGACATAAATCAATTAGAGGAGGAAG
AGCATCAATAGTTGGGCCAGGAAGGGGTGGCAGAATGCTCACATTGGCAACAATAGCTTCAACCATGTCATCATTTAATCTAGGGATCCTAGCATTACAAGAAGCAAAAAGTTCTCCACA
ACTTTGGCAATGATATCTATAAAATGAATAATTGAATATGTAAAAAAAATCATTAAGTAAACAATATAAAGGAAAATACTGAAAAGTTACCATTAAGGTTGACTTTCAGCTTTGAAGATG
TATGTAAACCAAGAAGTTTCTTGGTTGTTAGCTTTCAAGGAATGTTGGTCCATTAAGGCCTGGTCTTCACATTATCAGTTAATCATATACGACTTGGGCCAGTTATTAGTGTTGAGTCCA
AAATCCTTTGTGTTTTAATTATGAAAAACCTTTTGAACACAAATAATAAGACTTCTAAGTTTATGCCTACTAATGAGTTTGCTTAAGTGTATCCAGAAAAGACAAGTTTTGTAAAGATCA
ACAATTAAAGTAAACTTAGGGCTAACATGAGTCACTCAAAAAGGATAATTAGCTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATTACTCATTCCTGGTGTCACTTCAATTTCCTATTTAGGTAATA
AAGATCTTATAAGATTATAAAACTAAAAAGATCTAAAAGCCAAGAAAAGAAAATGGCATAAAGGTGGCAACTTTCCTACTTACTCGGAGATCCCTTTCTTGTGTTTTAGTGTTCATATTT
ACAATATAGTTTGAAAGAACGTCAAGAAAATATTGAAAAAAATAGTTTGAAATGTTAAATAGAGTTCCAAACAATCAAATGCGATGTAGTTCAAAAGGTAAACAAAAAACTGTAAGTTTG
GTTACAAAGTAGTTAGTTGCATAGACATGGGAAATTTTCACTGTATCCCTGGAATATGTACTCTCTTTCCTTTAAAGCAAGACATCTGACATGTCTCCATCTCGGTTGACTTCAATGTCA
GCTTTTCGGTCTTCGTGCCAGCCTAGCCACCGTGAGACAATTGATTTGAACCTCGACAACTTCGATTTCTTCCTTGATGTGAACGTCGATGGTCTTTCAAAAGGCCTGGGTGATGAGGGC
TTCAGTTTTTGACATCTCGAGGGAAAAGATTTTGAGCCTGGGTGATCATGGGGGGAGGGGGGGTTTGAGCCTAAGGGACTTGGTCTTGCCAGTGCTGGGCTGGCCGGCCAAAAGGACTGT
GCAGCCGGTGATTTTGTCGTCTTTGATCATTTGGAGGATCACACCGGCGGCTATGCGAGTAGTAGTATGCCCGACCATGTCGTCGAGACGACGTTCAACTCCAGGGAGGAGTCCAGGCCA
AGGCCACATATGTGGGAATGCGTGCCCACATGCTCTATGTGGGTCAAATTGCAACTCTCAAAGTTTCAACTCAGCCATTGTAGAAACGACAAAGACGGTGGGAGGGAGAAAGAGGGTTAT
GGAGTTTGTTTAGGGTTTTGACGGTTTGGTCTTTGGAGAGTGAGAATATGTATTCTCACTAGAGAGTGCGAGACAGTAGCTAGAGGGGCACATTCNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATCAACCAATATTCTCTTTATTCAAAAATAATATACATGTTATTTCTTATTATTCGAAAAAGAGTA
ACATTTGGGAGTTACTATGCAGGAAATTGTAGAACCATACTATCAATAAAGCAACCTAATTAAAGAATAAATTATTGAAAACTATCCTGAAATAATATCAATTCATTTATTGTTATAGAC
CCATATTTTCCCCTTTCATTTGAATTTGGAATTCAAGTAAACCTTTTATTTAGAAAATTAAGCTAGATTTTAAATTTCTTACATACTAGCATTTCACATGACATCTAATATCTTTAAGTA
GGTAGAATTCTTAGATTATCCTGATATTTTGGATGATATTTTGTGTTGAGATTAACCACATGAATTGATACCACACCAAGTGAATTCTTAATTATATTCTTGGTTATATGGTTAAGTGTT
AGGATGGGTTTAGAAAGGTCCAAATATGCTGTCAAAATTAAATGACTATGGCTAAGATATTATATAGGATATAGTTATATATTTGTATTATAAATTCTAATACAAATATCTAATTTTGAA
AGAATATTTGGATCTCCCTATACCCATCCTAACATTAAGGGGATAAAAACTAAGTGTCTAAGTGTCCTTATAATTGTTAGGATTATTGTTCCCAAAAATATGTTAGTTCGGTATGATTCA
TCAAAATCTGTATCACCAATGGATGCCATCAAGGCAAACTTTAATGCCTCAATTAAGGAAGGACAAAAAAATAGGAATGGGTGTTGTGTTTCAAAAGCATGAAGGGAGCATTATGGCAGG
TGCTACATACTTCACACCACACATATTTATATGAGCCTAAATTATCAATATATTATATGCATAAAATCTTGTGAATTATCCTTCTTCTACTCCAGTGACATGTTAAAGCTATAGGTTTAT
GTGACATTACCTCAACAACTTCAATTCCACCATTTTGGATGTGATTTCTGCCGTGAAGCTACTGGGAGGCTTAACCTGTAAAAACCAAGTTTGAAGAAGTTTCATTGACATGTTCTATAA
TACTTCTTAATAAATTGAGGGAGTATTTTCTATAAAACCTGTGACAAAAGAGGAAAAATTGTGACTCCAGCATGACCTCCAACCACTGGAACATCAACCTCTCTTGGATCAACTCCAAGT
ACCTATGCCTAAAAGAAGAAAACATGGCAGGAAATAGACTAGCCTCTATTCAGACAATTGCATCATATACTATGAAAATATCACAATGTAGAAGTATTTACTCTATTCAACCCACTGTAA
TACTTTTCAAAACTATATAAACAAACTAATTTGATCAAACAATTAACATTTGATTATACTTTTAGCTTGTAGTCTCCTAGATATTTTATTTTTGCAACATAGCAAGAAGGAAATTTAAAT
GAGTTATAGACTGTTTGTATAAGAACGACAAAGCAATGCTCAGCACAAAAGTATTTGCCCTCACAACATCCATGGTTGTAACACCCAATAGTCGCTTTGGATCATATGTACAAGCTTTCA
AGAAAACCTCCGCAACTATAGAAACTATGGAATTCACTGGATTACTAATCAAGTTGACAATTGCATTGTGGCAACACTTGGAAAGTCCTTCAGATGATTTGAGTGTGTGTGAGAATCACT
TGTTCATATATATTCTTTAATTCTTGCCAAACGATTACTAATTAAAGTCAACAACTCCATCAAATCTAAGTTCTAACACATAAAGCCCCAATTATTTTCAAGAGAATTTCTTTTTTCGTC
AAACAATTTTGGTTTGCTCCTAAAATTTGAGGTATTAAAAAAAAGACAGAGAAAGAAATTACCCTTAGCTGCAGCCTTTCGCTTCTCGAGGTTCTTGCGAGCCATCATTGAGATTTTTCA
AAATAGTTTATTTAAATAGAATATAAACTTGTAGTATATAATCTTAGTCACATTATTAAACTAGTTTTCATCTTTTAATTATTAAAATAAGTACTAATACTATATGATAACATGAACAAC
ATTGCAATAATTAGAAAAGGGAGAAAATGATATAGTTCATGAAGGAGAACCCACGATACTCTACGGGCATGTTGCCAATGCCAATTTTCCAGATTGTGATTTTCTCGAATGCTTCAATTG
GAAGCACGAAATGCTACTTCGGAGTGCTCTGTCGTGCTGGAGATGCACCACCACTTATTGAAGTTGGAGTCCTCTGTGTGGCATCGAAGCTTGAACCAGGTGCTGCAAATTTGGTCGCGC
TCGAAGAGAGCCTCACCGAGAGTGGCGGTGGCCCTGCCATAACTGTTGTTAAGGAGGTTGTTGTATCTATATGTGCCATCGGCCAAAAAGAACCTTGGGGAAGCGGTTGAGGATGATTGC
CAAAAAGAAGGCATAGTAGTTTCCGTTGAAGTCTCTCTAATGACACCAGCACTCGATGTCGTACTAGGAATTGCTGACCAGGGAGATCTCTGATGAAGACTCTCTAACGAAGCCTCGGTC
CTTGTCACACTCGATGAAGGAGAACACGTGCTCTAACACCTCCTTAGGCAACGAGTAATTTAATTCTCCTTCTCCTGCACGCTCACCACTTTGGGCTTCTCCATGATGGGCTATGGCTAT
TGAAGTGTTTTTAAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGATAAAATACATCAAATTAATTTATTAGCGATAAAATTTGGCAATTAAAAAGTTA
AAAGTAAAAACTAAGAATGAATACTATTGGTTTACATATTTGTTGTTAGCACCCACCATTCCTTTAAAATATAAGCTACTACCCCAACCTATGCCATCATTCTATCTCCACATACAAGAC
ATGGACTAGGGGCCAATACAATTACTATCAATTATCAATCATCATCCACCTGAATTTTTTTTTCCTATCATTTTCTTTAGACTGGGTTGGGGTTGATGATGTTGCTGTTGGAATATCTTT
AATCTTTAATCCTTAATTTTATTCTTTATGCGGAAGCTAAAAATTTTCAAGTACATATCCTAGAACAAATCACCAAAGGCCCTAGGATCTACAACATGCTTGATTATTTAAGATTAGATG
TTAAAGTTTGCTTGCGTCCAAGTCACATTGGATTGTACCGAACAAATAAATCCTAAGGTTTTGATGTTAATAAAGTATAAATTTTATGTATTAACCTTTCATGCTTAAGCTATAGGTTTA
TATATATCTTTATGAGATACAAGCAGAAAAGCGTGAACTGAAAGGCTCTAGACAAAAAACAAAGTATCAGTCATTGGACAATACTGCTTCAGCGCCCAACCCTAAGAAGACAAGTGCTTT
AGCACTTGGCTCACAGTAAAAAAGCATTGGAACAATTACTCAATCCTCAAGTACTAAAAACATTCACAAGAAAGTGACGTCCATAAGCTCAGTAAGAAACTCGCACCATAGCGCACAAAA
GGGAAGATTTAAATTGTCTTGTCTTAACATTCTTAATTCCTTTTGTCTTATGTTGTTAACATTTCTTTCGATTCATACAATGAAAGTCAGCACTGAGCACTAGGCAACACTAGCAAATTG
TACTTCTCTAAAGATATGCTATAGAAAGTGTTTCTGGTCCCCACTCTCTTTCTCTACATAGTAGCGGCCTCGTGTCAAGCGCCAAAGCTATTAGACAATGGTTAGCTAGGATCTCTAAAT
GGATGGAAGCTCTGAAGTATATATAAAGCTTGAAGATGTTTGTGTTAAGGTGGTTGAATTAGAAGAGAATATGGATGAAAGAAACATGAACAAAGTAAGTGAATCTTAGCTTTGATAAGT
TAGCAAGTTTCATTTTATTTGGGCTTATGGTGTAAACATTCTTTGAGTGATTAGACTATATTTTCTATTAAACATATATTGTTTGTAAAAGTCGGGAGTGACTTAGTGACAAAAAAATAC
TTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGTTCTTAATCTCAGGGTG
AGGTTAAGTGTAGTGCCAGGAGTGTCCTGGAGAGTACTTGGTGTAGTCAGAAGTGGAATAGAGAATATTTGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGATTCTTTTCTATAAATCACTTCTGCACTACTATATCCAAGTTTTGCAGTCTAGTTTTAAG
TACAATATGACTTCGAACCCGTTGGATGAAACCCTTCGTCCATTGATATCTATTTAAGAATTTTTTTTTAATAGACTAAGTTTTTATCCATCACACTATTCAACCCCCCCTCCTTCTAGT
GTCTTTCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAATCACATTGATATATCGAATGTTGTAGAAAAAGGCAATCATAATCCTTTAAACCCTCAGAGAAA
CGAGATCCCCAGGGATAGATGGACGGATGAACATAAGTCCAGATTTCTTCTCAACTCTCAAGCAAGAAATGCTTTGTTGTGTGCTCTATCTCATGAAGAGTATTCAAAAGTTCATAGCTT
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGAGGG
AGAAGATATCCAAACCATGTTTGGATGCTTCCAAACCATTATGAATAAGCTTCGCTCTCTAGGTAGACATTATGATATGTATGATCACATTGATAAAGTCTTACAAAATTTATCTAGAAA
GTAGAGACCACAAGTTACAGTGTTAAAAACCATCAAGAATCTTGACTCTGTGACTCTTGAAGAGCTCATTGGGATTCTAAAAGTCCATGAGCAAGAGCTTGCTCGAGATGAAGGAACAAA
GAAAGGAAAGTTGCTAGCCCTTGTAGCTCAAAGACAAAAATGCAGCATTGCATCCAAAGAGTCATCGTCCAAGGCCTTTGCCATTAATGACGCCTCAACAGAAGAACCTAATGATGATGA
ATCTGATAAAGAAGATGATGAGATGAGTGTGATCACAAGAAAGATCAGAAAAATCTAGAGAGTAAAAAACTCCTCCAAATTAAATGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAGGATCGTCCACAAGATCATTCAATGAGAAATAGAAAAGTCCAATCATCTGCGAT
GAGCGCAAGAAGCCAGGGAACTTCAAGTTAGAATGTCCTGACCTTGAAAAACCTAACGATAAGAAGAAGAAATTCTTCAAGTCCAAAAAAGAAGAGCCTCCTGAAAACTTGGGATGACCT
GGATGATTCCTCGTATAACGAAGAAGGTGAAGAAGAAGCCAACCTATGTATGATGCTTGATGCGACCACTAGTAAAGCAGAACCAACACTGGATGCAAGTTCATATGATGAGGACTCTCA
GCCTGATGACTTTGTCAACTCTAATGGTGAAAAGGTAATATTTGAATGCAGATAAGACTTAATTAAAGGATACAATCAACTTCTATCTATATATGTTCACATCTATAAAGCTTATAGAAA
ATTAAATAAATGATTTTAATATCTTGAAAAAGATCATGAGGATATCAAGAAAGCTCATCAAGTTCATTTAGTTGATTTTGTCTTGGTAACCACTTCGCCTGGTAGTGTACAAGATGCCTC
TGCTTGTGAGGAAGTCAAGGCATTACTGGATGAAAAGGTATCCAATGGATACAAAAATCTTCTTAAGGATTTTCAAGACTTGGAGGAAAGAGTAAAATCCTTAACCATAACTCTTAAAGA
TTCAAAAGAATGGTGCAAGGAAATGCTTAATTACTTCAAAAAGAATGTACCCTTGCTAATGATGAACTTGATAAGTTGAAAAAGAAGAACTTGGATGTCTAGAAGGAATGTTAGCATTAC
AAAAAGATGTCTTTTGATTTGAACCGTAAGCTTAAGGGATGTGAGGTCTTAAAGGAACTACCTCCTGAGATTGTAAAACTCTATGAGGAGATAGAAACCTTGAGAGATAAACTAGGAAAA
TTTGTTGGAGGTCATGAAGCCTTTAATAAAATTATTAAGGTACAAAGAAACCTCAAAGAAAAATCTGGCCATGGTTTCAAAGGCAAAAAGATTGTACATGGTGAAGAAGTCACTATTTTC
TCTTTCTATGGAAAAATGGGTCATGAGACTTATAAGTGCAAGGACCTCCTATAAAGGGAAACCCATCAAAAGGTCTATCTAGTGCTTACTAGCACCCATATGCTAACAAGAAAAATNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGCTTTGTACTATGTATGCTCTGATTAATACATATTATGTAATATTTGCATAGGTAATGAACTCAAGAAGAGTTTCATTTA
ACCTCGCATAATTTTTCTAATTATGAAATATCTGCTCTGATTATGTTTGTGAAATATAACTTAATACTCTGGTAATTAACAAGTTTGTTGAATGTCAGAGATATTTTCTTTAGAGACACA
AACAAGAGTAAGCAGTGTGTGACAATACATCCTAAATTGCTCTAATAGTCCGATCCTAATCTCCTTATCTTATTCTTTTGGTATCAAAATTTATACTATTTGTTATCATAAAAAAGAGGG
AGATTATTAAAGTCTGGTTGTGTCCAAGTCACATTGGACTATAAAAAATAAATAAATACCTAATGTTTTCATGTTAACAAAGTATAAATTTTATGTACTAACCTTTCATGATTAGGCTAT
AGGCTTATATATATCTCTATGAGATACAAGCAAAAAAGCATGGACTGAAAGGCTTTGGATGAAAAATAAAGTATCAATCATTGGATGATATTGCTTCAGCATCCAACCCTAAAAAGACAA
GTGCTTTAGCACTTGGCTTATAGTACAAAATCAATGGAGCAGTTACTCAATCCTCAAGTACTAAAAACATTCACAAGAAAGTAACGTCCATAGGCTCAATAAGAAGCTCGCACCATAGCA
CACAAAAAGAAAGATTTAAATTATCTTGTCTTAACATTCTTAATTCCTTTTGTCTTATGGTGTTAACATTTCCTTCAATTCATATGATGAAAGTCAATTCTGAGCACTAAGAGATACTAA
CAAACTGTACTTCTTTTAAGATATGCTACAAAAAGTGTTTGTGGTCCCCAATCTCTCACTCTGCATAGTAGTGGTCTCGTGTCAAGCACCAAAGCTATTAGATAATGGCTAGCTGAGATC
TCTCAAAGGATTGAAGCTCTAAAGTCTTTATAAAGCTTGAAGATGTTTGTGTTAAGGTGGTCGAATTACAAGAGAACATTCTAAGACAAAACAAACAAGTGTTGTAACATTGTCAGTCCA
TTCGATGAAAGAAACTTGAGCGAATTGAGTGAGTATTAGCTTTCCTAAGTTAGTGAGTTCCATTATATTCAATCTTACTATGTAAACACACTTTGAGTGATTAGAATACATTTTCTATCA
AACATATATTTTTTGTGAAAGCCAGGAGTGGCTTAGTGACAAAAAAATACTTGGGTCTTAATCTTAGGGGTAGATTAAGTGTAATGCCAGGAGTGGCCTTGAGAGTACTCAGTGTAGCCA
GAAGTGATATAGAGAATACTTGGTTGTAATCAAAGAATTAATTACTGGAACCCTTTAAGGTTAGAAGGAGAACTGGGTGTAGCCCAAGAGTTGAGGTAAACCAGTATAATACCTGTGTAT
TTTATTTACTACTTCTATATAATTGATTATTTTCTATAAATCACTTCTACACTACTATATCCAAGTTTTGAAGACTACTTTTAAGTACAACATAATTTTGTGCCCCTTAGAAGAAACCCT
TTGTCCATTGATATCTATTTAAGAAATTATTTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATGATATTAAAAGTTGATAGACTAAATTACATCACCTTTAGAAACG
ATAATTATCAAAATTAATATTTCCAAATTAAGGTTGTTTAATTTGATTGATTACTCGAATTGTTTTGACTACTAATCAAGGATTTAAATTACTTGTCTCCATGAGTGTCTCAATTCATGT
CCGACCAATAAAAACATGCCATGTAATTTAAAATATCCTACTAGACTTATATGTTTTTCCTATCTTGCCCCAAAAAATTTCCTTATAGTGTTATCCTTCTCCTCAACACTAACTTAACCC
ATCTTTTCCTTTCACCAACTTCAAATTGAACCAGCGGCACCCACAGTCCATAGAACCATCGACAATGACAACCCATCCAACAATTTACTCAATTGCACAAAAATATTATTGGCAAAGATA
GTTCGATTTTTGTGGTGACTGGTTATGTATAACTTGGAACCATAATAAAGTACCCTGTTGCATAGAAAATTGAGATTATTGAGCATAAGAAATAAAACTAGCATGTGCAACACTGCATTG
ATTCTTGATTTTTTCTGCCATGCCATTCAAGTGCCAATAATTTCTATAGACTCTTAATTTCAAGTATTCATAAGGAAATTTAGAAATTGGGAAGGGATCTCCTGTAGTGCATTGATGTTA
TTGCATGTAATCCTTTCATGGAGAGAACAAAAATATGCTAGATGCTTAAAGCCTTAAACTAGGAAGTCCTTGTTCCTACTGTATATAAATTGGATTAGAATTTTTTATACCTTATTATTC
CTCCCCCTCCTCCCTGTTGAATCCACTTCCCTAGTTTTAATTACGAAAAACCATTAGCAATGCAAATTGAAAGGATGATGTGCTTCAGTGATGACTAACATTCTGCTTAAGTGTTTCAAT
GTTTATAACTTTACGAAGCATGCATGTTCATTCATTCTAAAGCACTCATAATGATGCTTAGAAAGACTCAGAATAACTGTCAAAGTTAAGAACTTATAAGATTTCATGAAGCCCATCAAA
ATGATAAAGTTTCCTTCCCCTCAGAGTACTTGGGTCTTGACAAGATACTGAACAACAAAGGTCTTACATAGAAGACTTATCAAGGGCTACATGATGAGCATCCAAAGTCAAAATGAAGCT
CTAGCAGAGCCAACATTAGAATATTGAAGACCTTGACTCTGAATAGTAAACAATAGAATGACTTAGAAAGCATCACAGGGACAACATTAGTTCTTCCATATGATGCCACACATACAGAGG
GCACATCAGAAGACTAAAGTTGATGAAGCACTTCACTTTCCATATGTTGCCATATACACTAAGGGCACATCAGAAAGTCAAAGCTAACTGCATAAGGAACATAAAGTTAAGTTGTCCATG
AGGAGCATTGATGAGAAACATCAGAATGAAAAACTAAAGAATGCCACTCATTTTGACCTTGGATAGAACACTAACACACCATCAACTAAATTTCTACTTAGTCTTTCTAAAGTAATCAAC
TTTAGAATGCTTGAAGTTGTGAAGAAGTGTTAAGAGTGATGAAGCAGTGCTACTTCAGAATGGGATATCAGTCTAAATGTGACACCCTAAAAGTTATTATGAATAATTTGTAAACTGATT
TCAAAATAATTGTGTTCATTAATCCAATTGTGGAAATGTTTTACTTTAAGAAATGTGAGTAATTTTCTTTCTTTTTATTCCTTTATACATACAAGTCGTGACGAAAATATAAGTCATTTG
GTAAAAACAAATGCATTTTGAATATAAATCATACACTTTTTGAATAAAGAGAAAGAGAAGTGTTATGAAATTAAGCTGCTAAAATATATAAATAAAGAGTGATTCATTACAATAAGTACT
AAATTTGAAACTGAGGATACATCGCAGTGTGCATGTGTCCCAAAATACAAATAATAAAAAGTTGATGATTGTACGCACATGAAAAATATATGGAACCTAAGTCTACCCATACATATGCAA
AAGAAAGGAAGACACGTAGTCCCAAAGCAGTCATCACTAACCCAATCCTAAGGGGGAAATTGTACGCTAAAAGGGTGAGTCAAGAGTCAATAGTTAAGAGGTTCCTAACAACAGGGTTCC
CAAGAGGAAGCATCCCAAATATCCTCATTACTTTCCTTCATAGGCTACCTTGCTTCTTCTAAGGATGCTCCCTACTAATTATCATTGTGCCATCCTCCATGATAAGATCAAGTGGCTCTT
CTACTGCCTCCAACGGGTCCTCCTTGATCTCATCATCCTACTTAATGGGTGTGGGGCAAGCAAGGTTGTCACTGTATGCTCAGAATCCTTATCAGTATAAGGTGGCCTTGGCACGTTGTC
CGGGGTGTTCAAAAGAATATGATGAAGACAATGAATAGGAGATCTCTATAGGGAGGTATAGGTTGTACCCATCATATGAAATACTCTTAAGCTCAAGGAAAGACTAGCAACCATTATGTT
ATGGTTATCTACTGGATCTCACACGAATCCTAATGCATCACCTTTCCACTAACTCAACATATATATCATATTGGCTAGCTACCACTAGAACTCCTAGAACTCAATGGTCATACAACATTG
TAGTTCGGATGACTATGAGGAGGACACCCTATGCCATGGTACAATGATAAGGCTCTCACCGACTAGTTATGCCTCGCATTTGTTGGGATCGCCAAGTTGACACTATGGAAAACACAACCA
CAAAATCAGTGCCATATCCATAATAAACAAAAAGTAAGCGAGCATACCCCAGGTACCACTCTGTAAGGCCATCCTAACTCCAAAGACTTACTCCTTAACCACTTCTTACTGAGGGTTCAC
TTTAGTGTCACCATGGGGCCCGATTGCAAAGGTACAAAATGTCATCAAAAGGTGAACCAAGTCCAAGAATCATTTAAACTTAACATCATAAACAAAACAACGATCTCATCCACACTTCAT
GGTGCAAAACCGCTTATCGACTATAATCTAGTGAGCTCTCACAACTTCTAGCACGTCCCCCCATGCAACTCTCTTGAAGAAGTTCTATACATTCCACAGCGAGTTCAAGTCTGCTTGCAT
GTCTCTCAAGCATATTACTCTCTAAGAGAAAACATCCTAATCACATAGGTACTCATGCCTGAGTCCCTGTGAACTAATACAAACATTGCACCTCATTTGAGACACACAATATCCACCAAA
ATAAGGTTCTAGTCCACATCAAGACTCGGGCCTGAGTCCTTGCATCAATCACACAAAGCCACATATCTTTAGAGATGCATTGTGCCTACTAGAATGGGTCCTAGTGAACACCGGGACTTA
TGCATGAGTCCTTAAATCTACCACACACAAGTATTAACACACAAATCCATACCATCCCCAGTTGTAAGCAAATTGGGTCACACATAAAACATCACATGCAACAGTGCCCAAGGTCACACC
TCTTGGTCTCTAATAAAACATTGTATTCCACAGTTATAATAGTTCATGGTTCACATTCTCCAGGTATTTCAATCATACACATACAAATCATAAAAATTTCAAACTCATCACACAACACAT
AGACAAAAATTAACAAAGCAACACATCAATACCTAGTCAAAATTTAAACAATACATCAAGTAACATGCATTAAAATCCCTAGCTTTTAAAAAATAGGCAGATTCAAGCCTTTTCAAAATT
TCACAAACAATTTTGTTATTGAAAATTTTTCATTCATCCTTAAAGGAAATTTTATTTTCTTTCCAACAAGGTAAAATACTTCATTAGAAAAATCTACAAGAAAAACATAAAAATTCTACA
AGGCAGCAAGGCAGAGAGCACTTCAGTTTGGACATAGTTCAAAGAATTATGAATTTCTACCTCTTCCCAAGACCGAAAAGACTTCTACATTTTACAATATAAAGCTAAAAAAATCCTTTT
TTGAGCAAGCAAAAAACTAAACAAAAATTCATCCTATGTTGCTCTAAGTGAAATTTTCTTTCTAACACTTTTCCCAGACCTCAAAATTGACTTTCTTACAACATCTTTGTTTTGCTTTGG
CCATTAGAAAATGAAGATGCAATCCATGATTTTATAATTTACATGGCTAAAAATATTTTTTATTCTCTAGTTTCATAAAAAGTAAACCTTTTATTAATATGATAACCACAAAAGCCAAAA
AATTCAGCACTGCCAGCCATTCATTGCACAAGAAGATAATCACCTTGCATGTTCCAGATGGGCCTCAAAATGACCTCATCTCTCAAGGGCTTCAACATGAAATTTTTGCAAATTATGTCT
GCAGTAAAACAAAAAAATCATGAAAATAAAATCGGTAGATTTCATTTGAGGCTCAAGTCCAGAGGACAAAGCCTTCCAACTAGCCTCTCCCTTCTCATTGCCTATTTTCTAAAATCCAAT
CTTGCTTTATATATCCTAAAAGAAAAAATGGACAGATTCTCCTTTTTAATAGGAGCTCTTTCAAATCACAAAAATCAACAAAAAGAAGAAGAGAAGCCATGCATGCAAGTGAAAAGTTCT
TAGCTTTGCAAAATAGTTTGAGAAAACCCTTTAAAACCCCAATTTTTGCGCATGCAATGTAATGGAGGATCATTACACCATGGGATCCCAAAGGAAACCATGGGAGCTGAGTTCATAAAA
AATAATTCTCAACTTACCAACAATCTCAGCTCCCACAGAAATAGGAGAGGAGAGGAAAGCACACTCCTAAGCTTTACAAAACATAACACAAGGACCAAATTCATAATTTGTTTTTGAGGT
CTTCCTCTGAGAGTGATCTTAGGCAAGCACAAGGAGAAGAAGAGAATGGGGTTTGTTTTGGGTGAAGTTGAAGTGTCCAACTGAGTGTAGAGAGAGAAGGGAGCAAATGGATTTTCCTGC
AACTCACAAAGAGAGAAGAATTGAAAATGAGAGAGTGAGGATGTGTGTGTTGGTTGTGGATTTAGGAAGTGAGAGAGTGAGTGAGGTTGAGTGTTGATTTGGGTAATGAGGGATTAGGGA
ATGGTTTTGCTCAACCCCTTCACTCATTGGTGGGTGGGTTTTTGGAATGATGACTAAATGAGGGTTTACACTGTGTACTTAGTTTACATAGTGTAACCTCGCACTGTGAAAATATTTTTC
TCGTGACAAAAAATAATCTTCTACTAACTTTAGGAATTAAATCTAACCAGTTAATTTTTTTATAAAACTTAATACTTGAGATATTTTTTTGTGTAATTTAACAAATTCATATGATCAAAA
TATATGTTCCTTCTCTTACAAGGAATTAAATCAACACCAAAATATTCCAGCCAAAAAAATTGGGAGTAAACAATCACCAACAATTAGTCATTATGAGTATCAATTAACACTACTATTTTT
TATTAAATCACAGTCCATAACCAATTCAATCATAGGAAAAAAAATCCCAAACAAGATTAACTATACACATACACTAAGTTGTAATTTTTAGGGTGTTTCACTGAACTTCATCAACTAAAT
TCATCAAGTAAGGATTCGTTCTCAGCATACATCAGAGTGACTATTCCAATGGTTCTTCAAAATGTCCATCAAAAAGTTTTCTCAGAATGGCTCTACATGTTGTCACTTCATGACAAATGT
AAAGTGTACCTGCTTGCTCCAAAAGCTTGTTAGTTGAGTGAAGCCCACCTCAACGGTCTTCTTAGGAGCTTTATGAGGCATTTTCGAAGGGCGTGATGAACATGTTGAAGCATTCCAAAA
CAACATCTAGAGAAAGATCTCTAAGTGAGAAATCTTCATTTTCTGCTTTAATCCACTATAAGAGTAACCCACTTCTATATTGTGCTTACAAATATGTAATATTCTTTAGATAGAAGTGAT
ATATTTAATTCCTAAGGGAAATCCCTCTTTCAAGGTGAAGATTTGTAGTGTAGTAAAATACAGATCCTCTTTTATGTAGTATGTCCACAAGTGGCTAGCAAAGCTAAAATCCAATGGTCT
TGTTGATCTAGTTGAGGCTAGGATTTAAATCTAGTTGAGAAACTGGACAGGTGTTAAAATCCAATGGTTACTGGTCCAGTTATGACTAGTTGTGTTAGTGAAATCTCATCTTGAAGGGNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAACACAGAAC
CTAACAACCTTTTCTAACCAACAACTAAACTAAACTTGTTGTTTATCATAATGGTTTCAAGTAAATAACTATCTTTTAAACAAAAATCCTTGAACTATAAAAGATTTTTTTCCCCATAAT
TATTTGCATTTTCACTCTTAGCAACTTATATTTATATTTTGAGCTTAGAACTATTTTTCAATATGAACTAACATTAGAAACCTTTTGTTTTCAAAGGATGGATAAAAAAATTTTAAAAAC
CCAATTAAACCCCCCCCCCCCCTCCTTTTGTCTAATAAGAGAAAAAGGAATAATGACTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATGTTGGATTATTCATTGGAATATACAATGATTTGCATCTGGTGTA
ACAACTTGAGTGCATANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCAAGTATAAGTTTTTAAATCATTAATCAATGTCAAAAG
TTTGATTGATCTTTGATTGGGCATGTAACTTCATGCTAAATTTCCTTATCTGATGAATTATATGCTTGGGTGTTTGTTATTCTTGCTAATTTTGATGTGTTGCGTGTTTGCTTGACCCAC
TTGGGTTTGTTGTTGTTTTCTGAGCTAAGTGCATTTATGTCAAAACTATTTGTTGTGCTCAACAACTATATTATTAAAATCAATTTTTATCATTTAAGATTTTATGGTTTTCTATTTTAA
CTTCTCTCTCTCTCACCTACTATCTATATACACAGAGAAGCAGTGAAAACTGATTTCACTCTTACTCTTTCTCTCCCCTTTACTCACTCATTTTTTTTTCTTAAAATGGCCAAAACAAGG
ACTATTGCTATCAAAAGCACCTTCAAATCATCAACCTCAAAAAGTGAATCTATTCACTCACCCTTTCTTAGAAGCAAAAAAAAAAGGAAGAGCCAAATAATCTACATTTCCTTTGTGTTT
AATTTAGAGGTAACCATCACCTTCACACCCCCTTGTGCCAAGAGTGTAGTGATTCAGTCACCAAAGAAGAGGAGTGTTGTGAAAGAGGAAAAGTTTGAAAAGGAGAGGAAGAGGTAATTC
GTAAAATATGTTAGGCTCGCACAAGAGCAAGTGTATCCTACACAATAGTAACAATGGACTTGAAAGTCCGGATATCGAACCCAAAAGACCAGGTCTATTCCAAGTTTGTTAAGTTTATTA
AACTAACAGTAAAGATGATTAAAAGTGAGGAATTTAAAATATTTTTATGATTTTGGTTTTTATAGGAAAGCAAATAAAAGAATATAAAGAGAGGTTTTGAGTTATAATAAGAGTGACCAG
GGGTTATGACTCACTAGTACAAATTTTCCCCTAATCCTACTCCTAATGAAATTCTTTTCCCACTTAATTACTAATTCCCAAAATCATATAAAGCTTATGATCAAGGTCAGAAGATGTTCT
TTGCCTTAAATTAATACCCTAATGATCATGGATCTATCAATTTAAGTTAAAGGATAAAATCACTTCTAGGAATGATTAATTAAAGATTAACTAATCTATTAGAGATTACCCAAATAGTTT
GATCATGCAATTCAGTGCAAAAAATTCTCTACCTAGATCTACCAATTACATGCAGGTGATAACTATTATGCAATCGATTGAGTATTAGAATGACCTATGCCAAATAAACATTAAAATAAG
GAAGAAAATTAATTAACATAAAACAATGAGAAATTCCATTAAGAACAAGGAAAGGAGTACATTTGGACAATTACATCATAACCCTCGAACTAAGGGGACTATCTACTCAAAATCAAAGCA
AAATTAGCAATTCTATAAAATAAAATAAAAAGTAAAGATAGACATACCAATAGGCACAAAAAGGTGCACTGTGGATGTGGTGATTTCATAACAAGTTGATGCGTCCGAATATCGGAATAA
CTAAAAAATGGAAAATTAAACAATAAGAAAAGATAGAAAAAAAATATAAAAAGATGAGTAGAAAAACTTATTAGATACCAGAGTCAATTGTATCTAATAAGTTCTAACTATATTTTACCT
ACTATTGGATTTGAACCAATGGCATTAATACATTATTCCCAACAATCGGATTTTCAGCGAGACATAATCAAAGAATCTATACGTGCTCAAAGGTGTAAAACAGTTACTTGGAAATTTTTT
CAAAAAAGGGTGCATTCCCCCCTTTTTTGGATAAAATTGAAAAACCTTTTTTTTTGTTTTGATAGTTTCAAATCAATGAAAATCTTTTTTATGTTCAAAATTTGGATGCGAAAAAACTCC
ACCACATCCATGGTCGAAAGTGACGTTGAAGCCTTGGGCCATTATGGATTGACTATGGCCCTCTTGGATGACCACGACACTCATGAATTTGAGCAAGACACTCATGAATTTACCATGACC
CTCATGAATTGACTCCTCTTGGTTAACCATGACCCTTATGAATTGACCATGACCCTTATGAGTTGACCACGACCCTCATGAATTCACCATGAACCTTATGATTTGATCGTGATCATTGTC
AAACACGGAATCTAAAGAAAAAGGACCTAAAGTGTTGATTTATGGAAAGCTAACTTCCTATGCTCTTACAACACATCTAATGGAAAATACTCTATGAACAAGCGATAGTAGGAAAGATAA
CTCCTCCATACCTCAGTTGATGCACAAAAATGGTGAAGAATGAGTGGTTTGGAGCTTCAAGACTCAAGAACTCAAGCAAGAAGAAGATAAATCTTTCTCTTTTCCTCTCCAATGGTTTAG
CCAAAGTACAAAACAAAAATGATAGCAGTTTAAGCACAAATAGGGTGGACTTGGAGTGTTAAACAAGTCTTGGAGTTACCCAAGGTTCAAGGGTCCCAAGTGCCCATTGGTTCCTAAGCC
TCTCCTTGTCACAAAGTGACTTTGATTGAGAGAAAAAAATTGATGAAGGATTGGGAGAGAGAGTGAGGGCTAATTGTGCAACTCTAGGCCCTTTTTGGGTGGTTTCACTTTTGAGATTTT
AACCATAGCAGGCTAAAGTGGGATTAGACATAAATTCAAAAATTATGTTTACCAAAAGAAGTAAATGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCAAATCTAGTGTAGTGAAGATCAAATAATAAATTATAGA
ACAATATAATTGATTACCTTGAGGCCCATATTTCTTAGAAACGGCAAAGGCTTCTAAATAATCGATTATCTCAAGTAGATAATTGATTATTTCATCCTGATTGAAGAAGAATATTACTAT
GCANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTTTAGCATATAATTGATTATTTTTGTTTTGAGC
CTAAATAAATGAACATTTTGAAGGTTTTTGTGTGTGACACTTATTTTTCATATCTCACTTTGAGTTTTCACTGAAAGAGTCCAAAAAACCTTGAATGTCATCACCCGTTTTTATTCTTTG
CTGCAAAACCTTTTCTATCTTTGCCTTGTTGTTATAAAGAAAAGTTGAAATTGCATTATGAAGTCTATCATTAATTGTTACATCCTTCACCAAACAGGTGAATTATTTCCATAAACTTTG
TTATGTAGGTGCATGTAGTGGGTTTCTACATGTGTTTAGGTTCTTCTTGATATGTTTTCAGCAAGGGTAGCATGTGTGATTTCATATGCATGTGAGTTTGTATGTAAAACTCTAAATTGT
TAGTAGAAAATCCATGCTTTGAATCAAACTAGATGTAGATTTCGTTTGAAATTCAACCATAATAAATCTCTTGAGTAAAGTTCTCTAAACCCTTCTTCTCTTTACTTTCTTGCATATGGT
TTTTTTGTGTGTTTAAAGGTGTAATTTGATTTCAATACCTTAATTGAACCTTAACATTGAATTTGAGTACACAAGATGAATCGATAAAGCATTTTAGCTTCTAAATCAACAAGGGATTAA
GATTAAAGGGGATCTTGCAAAAAGCATAATCACATCTTAGAAAAGTTTTTAAAAATCAATTCACTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNACACTCTTCCTCGCGTTCTTGTCTGTTTGCCTCCTCTCGGTTCGCCTCCTTGCATGTTCCCCTCCTCGCACCTCTTTGTCTCTTTGCCATGTTTGGTTCGTTAGTAGGTAAGTT
TGTCAATACATCCTATTCCTCATGCTTCCTCTTCCTCGCATTTCAAGTTCTGCCGTCACCACCTTAGTCGTGTTCCGTCTTCTCCATACCTCGTGACAAATAAGCCCTATTTGGTTTCAA
GAAGAAGAAATATGAGTGAGGTGGTGACGGGATCACAATGTGTTTGCTTTATGTCTGAAAATCTACTCTCTGAAATTGATAATGGTGTAAATGTTAGTGTTTTCGTTATTGTGATTCTCT
AATGAAACTTGTGTTCATAAGCTATGGTAGTGTTGCTGTTTGTTTTTTTTATTTTTGCTTGGTTTGCGATTATTACCATGTATATAGTTGTGGCCTTTTGGGGTCATGAATATGGTAGTA
GCTTCATGTACACACGACTAGAAAATAGGCTTTGGTTGCACAATTTTGTTTATGGTTTGCATGGTTCTGTGTGTATGTGCTTATTAATGGGACTTTGTGCTGGTGTGAGAATTCTGTCAT
AGCCTTAGGCCCCCAAAATAGAAATATCATATTGGTATCATATTGGTATGTCAAATGTATCATGCATATTAATGTCATGTTTATATTGTAAATGGAGTTTAGAAACCATGGATGAACATC
AACAAAACTGGAAGGAAATGGCTAACATAATGATGAAGATTAACAAAGAATTAGATGAAATGTTCAACACTGTTCATGTTATTGATCAGGTTAGAAATTATTTCAAGACAATAATAAAAG
AAACATGACTTGATATATAATAGTACTTTTGCTTATATTAATTTGTTTGTTAAATGTAGCCTTACGGTGAAGTGAGTAGGTCATTTGTTATAAGATGGAAAGATGAACTACAGCCTACGT
GGCATCTGCTACACTCTAGTGGCAACATGCACTCTGTCACATATCACCAAGATTTGGTGAGCCCAGCTCTACTTGCTGGATGGATGGAACTTAGAGAGTTTTATGGACTCACTGGAAATC
ATCAAGTCACCTTGACCCACTATGGACAAAGTATTTTCCTCCTCACCATCTTCAAATGCAGCTCTGAACCAAAAGCTTTCCCTAAATGGCACTCCTTGTACCACCAAGTTCCTAACTCAG
TCACTTTTAAAGTCCTACTTACTAAGTACAAAGTGACTTGCAGCAGTTTGGTGAGTAATTAAGCACTCTTCTCTTTATGTCAAATTTTGATATCATATAGTTATCTAATATGAATTTCTT
TGCATTTCAGGATGTGCCGAGTACCATGTACTCATTTATGAAAGTTGCAAGATTCACTCATCTAAACTTGGAAGGGACGAAGTGTAAAATAGTTTATAATCATCATAGGAAGACCACAAA
AATTGGAAATGGACGGAGGACTTTTGCACAAACACATAATTTTCTTCCTGGAACTCAAATTATATTTCAGTTCCCAGATGCAACTTCTAACTTTGTTTTATTCTGGCTTTGTTTGTAATT
AAAGTACATTACTACTCCAATATATTATCAATTTGTAAATTTTTGTTTATAATATGTTATTTTGTTTAGAAATGTTTATAACTACCATTGGTGCATGATATATTGATATACTTTGTTTTA
ACTTTTGGTGCATGGCTGATTTATGCGTTTTTATACAACTTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAC
TCCCCCACCTTTGTTATTTTTCCTAAGTCATTATATCTAATACCAATTTTACTCACTTTTAAGAACATAAAAGACTAAAATGAACTTTTTAAAAGTTACAAGACCATTGTGAATATAATT
GAAAACATAAAAAATTAAAAGTGTATTTTAACCTATCTAATTTAAAAGGAGATGAAATATTTCTATTGTGAAACTACTTTTTTTCTTTACTAAGCTGTTAAACAAATTCTAAAACTTCAA
CTATTTAATACAAGAATTTTTTTAAACAAAACATATACTTATACAACAATAACCATGAAATAATTTATTAAGATGATATTTGCAATGTATATTGTAGTAAATAAAATTAAAAATATCTTT
CATGAAATAATTTTAATATTGATGATTTTCTTTATATATAAATTAGCTTCTTAATAAATTTTGATTTTACTTATAATAAAATATNNNNNNNNNNNNNNNNNNNNNNNNNAATTGATTAGT
TAATTATATTTCATGAATAGTCATTACATTAGTATCTAATGCAATTATTTAGATATGAAGAAGCAAAATGACACCAAATAATCATAACTACTTTTTAAACCCATATGATGCACAAATTTA
TCTATATTATATTTTTTAATATTTTTATCTTTCTAAGAGTATAAACGTAAACAAAATTATTTTTATTTAAATATTTAGTAATATATTATATATAATTACAATAAAATTTTGGATTTTATA
TTAAAAAATATATACTAATATTTTTTAAAAATATAATTTATTTTTTTTCAAGTAGTAATAGTGATGCAATACTTGTATGAACTTTATAAATAAAAATGTAAATACAATATCATATTGCAT
GTATTTTTCATGTTTTTATAACTAATAATCTTTAACTACATCTATTGTAAAAAATATTAATACATATAAGATAATATATAAAATATTTTTAATTATTAAAATGTAAAAAATTGAAGGCAA
TACATTCCACGTATACACAACAATTAAAGGCCTATTTAGGGTGGTTGAAATGTTTTTGCTTTTGGTTTTTAAATGCAACTTTCAAAACAAAATGTGTTTAGCAAAAATGGAGTTAAAATG
ATTTTTAAATCATTTTTGAAACACTATTTTTAATTATTAAAATGTGAAAAATTGAAGGCAATACATTCCAGGTATACACAACAATTAAAGGCCTGTTTAGGGTGGTTGAAATTTTTTTGC
TTTTGGTTTTTAAATACAACTTTCAAAACAAAATGTGTTTGGCAAAAATGGAGTTAAAATGATTTTAAATCATTTTTTAAACACTTTTATACTTGTTTACAAAAAGAAAAAAGGTTTTGT
GAATTTAGTTTGGTTTTAAGAAAGCACGTATTTTCCATATTTGACTATCGCATTTTTTGTTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACAAAAGCATTCTTAAACTAATGTTAATATAATAT
GAAACTTTCAAATTGATTTTATTTTAAATTAATCATATTTTAAAACATGGCTTTAAAATTTTTTGAAACTAAAACTAAAAAATAGTTGTTAGTTTTAAAAATTTTGAAACTCAAACTTAA
AAACCACCTCAAACACAACCTAAAAGAATTGTTTTTTATGTATAATGGTGTTCATGAGGATTGAACCTAAANNNNNNNNNNNNNNNNNNNNNNNNNATGAATTATTATCACGAATCACAT
TTTTTTAACAGATAAATTTAAAACTGTAGACAATAATACTATATTTTTATTTTNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAGAAAAGATATAATTGTACTTAATGAATGCATACAATA
ATTAATAGTAAATAAATAACTAAAATTATTTATATATTTTAAAAAATACTACTCATTAACAATTAATAAATGCATTATTCTTTTGTCATATGCTCNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNGAGTCAATTGTTGGATCAAAGAGTTTGAAGACTAGTTTTAGGATCTTTAAGTCATAAGATCTGTTGGGTAGGATCTTTTAGTCTTAGGATCTTTTGGT
TTTTATAATTTTGCAATGCCAAACAAATTTTTAAAGATGTGGCATTTGTATTGGATGTTTTTAGACTAAGCATGTTCAGTGTTTAGACTTAGTTCCTCTTATCCATGCTTAGTGGCTATC
AAACATGAGAAGATATATGGATTGATCTCAAAGTTTCTAAGAAGCAATTAGTTCAAACATTGTGTAATAAACTACCAAGTTTAAGTAATCAATTACAAAATGTTAGAACATGCAACAGAA
CTTACTCCTCTTGAAATATTGGCAAGTTTTATCGAATTAATCAATTGCCAAGGTTTGTAGCTCGATATAATCAATTACCACATAGTGTAATCGATTAGATTGTGTCTAGAAACTTAGGAG
CTCTCTATGTTTCAAAATAAGTGATTAATGCAGTTGATAATCGATTATTTCATAAACCATAGAAGCTTGAGAAGCCCTCTACTTGGGGATGCAAAACAAGAGGGATTTGAATGAATTAAT
TTATCACCCAAGTTGTGAATCGATTAAATCTATTTTTTCTATTAAAACTATATATAGCCTCCCTTGTTCATTCTCATTAGTGACTCTTAATTAGATCTTATCTTTTAAAAGTACTTTCTA
AGAGTCATCTAAGGGAACCACTCTAAATTTCAAATGATAAATTCATATGATCAAGATTCATTCATTCTTCATCATGGTTTAAGCAAGGAAATAAAGGTTTGAAGATATTGTGATCTGCAC
ATTCAGGTGTATTCAATCCTATTTTGATTTCTAACTAGTTTTTTTACTTTGATTAAGGTTATCAGGGAGTTTATATGAGTCAATAGGATTTCAACTCCTAATCTTTCCTTGTAGGGTTTA
AGAGAAGAGTATTATTTTAGGGAATTACTTGTGCATAGTATTTGTACTTGATTACCTATTAGTGGAAGTTCTAAGGGTTTTAGAACAAATGGATGTAGGTCCTTCTAGGATTGAACCAAT
ATAAACCTTGGGTGTGATTCTCTCTTTCTTTAAACCTTTTCTTTGGCAATCATCTTGGTAATGAAATTGTTGTAAAAGGTCATAATACTCTATTTTTCATAGAATTGTGTATTCATTGTT
TTCTTTGTTGAAAATCTTTATTATCTTCTTTTTAAGAAAACTTGATCACATTGATGGGTTAGTTTTAATTGTACCCTAAAGAACGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNGGATCGTGAAGTTGAAAACACAATAAGTGCTTCTGATTCTAAAACTAATCTTGATGAAATTATGATCAACTTTTAGATGTCTTCAATGAGATAAAT
GAATAGGCTCGATAGTTATCTCAAGACAAGAACACTCTCAAGGGAAAGTTGAAGTGGCATGTGGATAAGATAGTGAGTTGTCAAGTTTCAAATTGAAAAAATGAGGAACTTGAAAAAGCA
TTAGAAAACTCTTCTTACAATGACAAAACTATTTCCAAGTCTTCCCCCTCCCAATGTGAAATGTGCAAGGAACTTAAATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTTGAACTTGGAATGTTGAAGAGTTA
AGGTTTTGTCTTTTCAGAACTCCTTGAGTATCATGGATTGAAGAAGCTTGTAGAGATGAAGGGTGCATTCTACCCTGAGTTGGTAAGGGTTTTCTATACTATTGCCTATATTGATGGTGA
TACTAATTTCATGTGTGTTGAGGTGAAGGGGAAGTAGATTGTGATGACCCTAGAGTTTAGGAAGAAATTGTTGGTTTGTCATCAGAAGGGATGATGGCTAATGATAGAGGTCTAAAAGAT
GATGGTGTGAAATTAAAAAAGGCAACCAAATACAAGAACTTGATGAAAGATACCTCTACATTCACTACTATCGTGTCCAAAGGCATGGGCAAGGAAAGATTTGGTAGAAGCCCCTTGTTG
TTGGAACATATGCTTCTGGCTTATGTGATTGTCTGGATCATTACTCCCAGGGGAGCAATCATGCACAACTAACAAAAAAGGATCTATTTCTCATCAGCCTTATGCAAGGGAGGATGAAGC
TAGACTAGGTCAATGTTGTTGTAGACAACATGATGAAGACCAAAAGGATTGGCTCATTCAAGTGTCCTTATGCAATGTTGATTTCTAGGATCCTTAATCACTTCAAGGTGGATACCTAGG
ATGAGATTTTTGATTTTGTAGAGCTAGAATTTGAAGTGAAGTCCAAGGTTCTAAAACAAATGGACTACATTGAAGCAAATGAAGAAGGAGGTGGCTGGATTGAAAAGCCTAAGGAAGGTG
AAGGTACAATAATAGCAGCAACAGTTGAAGAAAAACTGATGAATCCTTTTGAGCTGATGATGATGGCTAAGATGGATGAGCTCAAGAGGATGCACAAAAAAGACTATGGGGAGATGAAGG
AGTCTTTTGAAACAATTTCAAAGAGGTTGGATGCTATGAGAGCAACTCATGTGGATGATCTATTATTCTTCCCTTAGTCATCCCCTTAGGACCTCTTTAGAGTCTAGGATAGTTAGCCTC
TAAGCTCTCTAGGACATAGTCTTGATGTTATTTTGTGATATCTATTATGTTGAATTTCTATCAAGTTGTTTTGTATTTTGATTAACGATATGTAATATGTTTCAATTAAATGACCTTTTC
TATGGTTTACCTAGTGCGTTATACATTATTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTGTATATACCTAAGATATGA
TTGATTGTGTACGTACCTAACTACTATGATTTGAATATATGCTTCTAATAAGTTTGTTAAACATGTTGTAGAACATGTACAAGATCAAAGGAAAACACCAATACACATGAAATGGTTTGG
CATGATCAAAACCAAAAAGAGGGAATTGTAGGATCAAAGAGTTTGAAGACTTAAAGACTAGTTTTAGGATCTTTTGGTTTTTATAATTTTGCAATGCCAAACAAATTTAAAGATGTGGCA
TTTGTATTGGATGTTTTTAGACTAGGCATGTTTAGATGTTTAGACTTAGTTCCTTTTATCCATGCTTAGTGGTTATCAAACATAAGAAGATATATGGATTGATCTCAAAGTTTCTAAGAA
GCAATTAGTTCAAACACTGTGTAATAGATTACCAAGTTTAAGCAATCAATTACAAAATGTTAGAACATGCAACAAAACTTACTCCTCTTAAAACATTGACAAGTTTTATCGAATNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGAAACTTAGGATC
TCTTTGTGTTTCAAAATAATTTATTACCACAATTGATAATTGATTGTTTCAAAAACCATAGAAGCTTGAGAAACTCTATGTGAAATGAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNGCAAAACGAGAAATTTGAACGAATTAGTTGATTAACCCATTTGTTAATTGATTAAATCTATTTTTCTGTTAAAACTATATATACTCTCTCTTGTTCATTCTCAT
TAGTGACTCTTGATTAGATCTTATCTTTTATAAATACTTTCTGAGAGTCATTTAAGGGAACCACTCTACATTTCAAACGAGAGATTCATGATGACCAAGATTCATTCATTCTTCATCATG
GTTTGAGTAAGGAAAGAAAGACTTGACGATATTGTGATTTGCACATTCAAGAGCATTCAATCCTATTTTGACTTCTTTCTAGTTTTTGACCTTGATTAGGGTTATTAAGGAGTTTATGTG
AGTTGATAGGATTTCAACTCTTGATCTTTCTCTTGTAGGGTTCAAGAGAGGAGTAGTATTTTAGGAAATTGGTTGTGCATAGTGTTTGTACTTGATGCTCTATTAGTGGAAGTTCTAAGA
GATCTTAGAACAATTAGATGTAGGTCTTTCTAGGACTAGACCAGATTTAAGTATAAATCGTTTGTAATTCTCTCTTTCTCTAAACCTTTGCTTTGATAATTATCTTGGTAATGGAATTAT
TGTAAAAGAGCCATAATACTTTGCTTTTCATAGAATTGTCTATTCATTCTTTTCTTCGTTAAAAAAATATGTATTATCTTGTTTTAAGAAAATTTGATTACATTGAGGGGTTAATTTTAA
TTGAACCTTAAAGAATGGATTGGTAAGTATTTGAAAATAATCTATTCAACCCCCTTCTAGATTTTCAGTTATTCAACATAATGTACTTAATAAATACATACCATAATTACTAGTGAAGAA
ATATGTGTGGGTATGTATGTTGTGTGGGTGGGTGTGGGGAATTTTCTAGATTAAAAAACATATTCATTTTTTTCATTTGCTCATTTTATTATTTTAATTTTATTACTTTAAATATTTCTT
ATGAAAAATAATAATTGAAAATGTATTTCATCATCTATGTATTTTAGTATTAATTAATTGATATTTTAATAATATTTATTTCATTATTTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTATTATAAAATTTTGTAATANNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTTTGTATAAATATTATTTCAGAATTTTAA
TTAATATTATTACTAATTTTATATTTAATTTTTTAAAATTTTGTAATAATATAAATAAAATAAGTACCTTATTCTGGAATAATTTATTATAATATTTTTCTCTATATATATGTATAAGGA
CTAATATAATATTTATTGTTAATACCTAATATTAAAATTATCAAAGTTAACATTTAATTATAAAAATATAAAAATTATTTTTTAATTATCAAAATTGATATTAAGCACAATTAATATAAG
TAATTTAATTCTTCATTAAATACATATGTTACAAAAAAAAAAAAACATATGTTCAATGGTTATTATAAAATTGAAGTTTTGATCATAGTCAATATTTGTTAAGTAAAATTTACTAGATAC
ATAGATGCATCCTCAGGGACAAAACTAAAAAAATTGTTAGGGGGCAAAAATAATTTTCTTAACACACATTGGGTTATACTATAAAAAGCCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNCACACGACGCTAGCGCTCTCTCTCCCTCTCAGCACACTAGCTCTCTCCATAGCTCTCTCTCCCTCTCAACCACTCTCACGCACCACATATAGCATTTTCTCACAAGTAAGTTT
CCCTTGCAATTTTGACCCACACTCTCGTTGTGCCACGGTGTGTTCATTTTTTTTGTTAATTTGTGATTTATTTTTTATTTAGTTGTTTGATTTCATTGGTTTTGTACTGTGGGTACTCAT
TGTTTGATTTTGTTGCTCATTGTTTGATTTCGTTAATTTGTACTGTAGGCATCTTTGCAAATTTGTTAGGAACAGTGTAGGTGCTTGTGTTTATTCTTCTATGATAATTTTTGTGTCTTC
ACTTTATGTTTATTCTTCACTGTGTTTAATCCATTGGAGGCTGAATGGCATTTGTTATTTGCTCCCTCTGATAAATTTCTCTAAAAAAGTATCTAAAAAAGATCCAAGCCCATAAAACCT
TGAAGTTTTGGAGAATAATAAAGAATGAGAGAGTTTATATGACTTTTAGAAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAA
TTGATATGCTATTGTGTTGAGCGTGAACCCTATAAATCGAGTACTTTTTCTAATTAATATGAATTGATGAAATAAAGGAGAAATTTAGAGAGAGATATTGATTTTGTATTTTCTCTTTTT
CTTGTTGTTTAGGTTTTTATATATAATTTAAAAAGTTAATATCATAATTGAAATTGACCAAAGTGTTCATATAATTATTTAGAATTTGTGCATTGAAAGCTTACTTTGTAATTTGTGATT
CAATATGATGTATGCTAGCTTATATATATATAGAGGTTGTTATTTATATTAATAATTTATGTAAATAATATTGTAGAGTGTTATAGTATGATTCCAAAAATTATTAAGTGTTGGAGTTTG
AGAATATTATGGTTAAATTTGATGAACATGTGTATGTTGTACCTTATGAATATCATTAGGAATGTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNCTTCTATAATGATTGAAGATTGAAAAATTAGCAACTGTAACTCAAGTAATTGTACAGTTTTATGTCATCAGAAAATATAAAGGGGTTGTAATATTG
CATTATCAGTAAGTCTCAAATTGTATTTACTAAATCTTTAAAGTCAAGTCAAGTAACATGCAGATCAAGGAATTAAACAGTGTGCGGTAGAGCTAAAACGTGCCTAAAACAAGATACTTT
TACACTGTGAAATAATAAAAATGCATTTGCTCTTTAAAATGCAAATACATAATCTGGAATGCTGCATTAACTCCCCGATAAAGACCTCTATGGTGTCAATAAACCAAATGCCTGCGCCAG
CAAAATAATTAACTTTAACTTCTAGAATAAAGGAGAAAGAAACAAAGATACAACACAAATCACAATAGGAGTTTTCAATAGTACCAGAGAAATCTCACTAATTAGAATTGCATCAGTAAG
TGATCACATGAATGCTTCAGGCTCAAACCTTGTATACAAGGTCCCATTTTAATCTTAGGAATTAAGATGAAGAATCTAAAATACCCCGTGTCTCTAATACTAATGGTTCAAGAATATTGT
CTCTATTCTCCAATAATGTCAAGTGTTAACATAGTAATGCCAATAAAGACTTTTTACCAACCAACAATTCCACTTTTGGTCCTTACTAGTTCAATGATTCATAACGATACAATAATCATA
AAATCCATATTCTGAAATCCACATTCCACCTCAGCTTGATTACTATCATGATTATTTTTCTTCTATCTTCTCTTTTGGCAAAATCCGATTAAGTTTGGCTTTTGAATTCATTTTTCCATC
GTTAAAATGTAATAATCTATAGACTCAAAAGTCCAAGCTTGCATCTAATAATTTGTGCATGCAATTATGCAAAAGGGAAAGGGACTGATGAACAAGTAACTATACCTGAATCTGTTGTTT
ATTACTAGTTGTGATGTTTGATATGGTCCAACAAGCTTCCTTCTTGATGTTTTTTTAATAATTATTGGTCAACAGATTCAGAAGGCAAGGAAGATTCTGGTGATTGATGATAACCTATAA
GGCAAAACACTAGGTTAAAGCAACCAGGAACATAAAAATAAAATAAAAATCATAGAAAGCATATTTTGATATCAGAACGCATCGTTTCCAAAATAGAGGCATGACTAGGTCATCTCAGCA
ATAACCTTATTATTCTGCAGGATTGTTCATGTGTAAAACAAAAGGAAAGTAGAAAAGAATATTGCAACTTGCAATTAATAGTCACTGTTTTGCTTATTTTGTAATGTACAAAGGCAAAAG
TAACATATTACTGTACATAAAAACCATAGGAATTAGCACTGAAGGGAATGGGTGCCTGAATAAGAGTAGGAAATTTAGTATTTGGCATAGATGATATCACAACTATTCAAGCTACTGAGG
AATGGACAAGATTTTGAGATACATTAACTATGAATATGTTTGCTAACTATCAAGTTAGAAGAAACTTTGCTTAGGGATAGTTCTTTTTTAAATGTAACTTGCTATTGCAGACAAACTTTG
TGTGCTTTGTTACTATTGTACTTTGCTATTGAAGATAGACTTTTATGTACTTTGCTATTGCATAAAAACTTTGCTTGAAATATTTTCTATGATTGTGCAGTGAACTAGTCAAATGAATAA
AGTATGTTGTATCTAATATTTGTTATGTGCAGGTTAAATAAGTGACATTAACTTCAATGGAGTCATCTAATAAAGAAAATGACGGACAAAAGAAAAGTTTTAGGAAAAAATAATGAGGAA
ACAAGAAGTTATTTTACATGGAATTTGGAGATGGAACGTGTACTGGCTGATGTACTTAGAGATCAAAGGAATTTGAGCAATAAGGGTGACGGAGGTTGGAAAAGGTCAGCATTGAATGAT
GCAGCCGCAGTGTTGTTTACAAGCTTCAATGTTAATGTCACATCAGATAATGTCAAAAACCGTATCAAATTATGGAGATCATGGTATTTGATTGGGAGTATGGTATTGCAAGTGACATCC
TTGGAGAGAGTGGATTTGATTGGGATAGCACTAAGCACATGATCACAATTGAGAATGAAAATGCTTGGAATGAATATTGCACTGTAAGTATTCTTTAATATGTTGCTATTTGTTATTCAA
AGTAGATTGGATTTGACTTTTTCTTTTTTTTTCCAGTCGCATAAATCGACTAAACCCGTTTTGATTCAAGGTGCTTCAAAATTGGGATGATATAGTGAATTTGTGTGCTAAAGATAGAGC
CACCTGTCATGGAGTTGAAACTGTTATGGATGATGATGAAGTGATGAGTAGAGAAACAAATGAAGTGAAATTCATGGGGTTAGGTGCTACTGCTACCATAGACTTAGAAGAACCAAGCTC
TAATACAAAAAGAAAGACGAGGTTCAACTTCTTCGGGCACATTCTCACAAGAGGGAGAAAAGGAAGGAATGGCGGCTTCTTTCAAGAAGTGTCACGTGAGACAGCTTTGATACCATATCT
TAATAGATAACAATGGGCTAAAAAATGGTTAGCTGACGATCCAAAGCAATTAGCTATTGTGAAAGCCCTTCCAATTCACAAAAAGACAGATTATGTTTTAACACATCTTACAGAATGAAA
CTTGGTGAGTAAACTTTTGTCTACATTTCCAATTTCAACTTTCAAATTATAAAATTGTGTCTTTTTCATGCCTAGTTGAGGTCATATTTTCACTATAGTTATTTGTCTTTCCTGTTGTGA
CTTATATTATCTTGTTTCTTCTTCCCTAAATGGCAGCATTGGATGTTAATTATTCAGGCTCCTCGACCTTTACACTTGATGATGAATGAAGATTAAGGAATGAAGAACATTGTTTTTTTA
ATTTCTTTTAGCTATTAGGATTGTTATGTACTCAATTAGTTTATCTTAATTTGGACCTTGTAATTCTTGTCTAAGATCTTTGTTTGCAACTTGATTAATTAGGACCTTGTAATGCTTGTG
TTGATTCATGTTTATGCGTTGGTGAATAATTAGCAATTTGAATTTTCTTCAAAATTGTATAAGATTCAAAATTGTTTAGCATTAAAATTATTTTGATTATTTAATTANNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAGAAATTTGGGTTAATTAAAAAAACTCAAATGTATATTAAAAATCATAGC
AATATAAAAAATTATAAATTCAATACTCTTTCAGGTTTATTGCAATAGTAATTAATAGATTGAAAAGTTTATTGATCTTTGAATATTTTTATTTAAATTTTAAAGTACAACATTTATTAT
ACTTGATTTAAATTTTCATGCAATTAAACGACAACGTTTGATATAAAATGTTTCCTCTTGGTCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAATAGGATTTGGTCAACTTGATCCGCAAGCTTCTTTAAAATGCTTGGTGCTGGTGCTGTTGTGATGCTCTGCTCTACTTCTTCCTCGC
GCATTCTCCTCGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NGGAGAAAATCTTACCCTTTATTGTTCGCTCAATCAACGAAGCCCACATTGGCATTGCCAGATGCACTTGTTCTCTCTGCTGATCTCTGCTCCTTCTTCCACTCTGTTTCGATTTTCCAC
TTCCAAGGTTACACTCTAAAATCTTTCTGCTATTGTTATTGGATATTCTTTTTGTTAATAATAGTTACTGTTCCTTTTCCACCGTTTCTTTGTTAATTGCTTTGTGTTTTTATCTTTTGA
AGTTTCCACACATACCCAAATTGTTTTCCCTTCTTCTATGTGGTTTTTCTTAGCCCCAATTTCGTAAAGTTTTTGTTCTTAATCTTTAATACAATTGGGTTGTTAAATTTTCTTCTTGGG
GTGTAAAGATCTCAGAATGGGGATTTTTTCTTGATTCTTTCTCAAGTTAAATTTTAATCTTGGGGTGTTAAATTTTGTTTACCTCAGTGTTAGATAATTCTGATTCTTTATCAAGTGCAA
GCTTATCACTAGTTTTTTCTTGTGACTTTCAGGATAAGCATCCTTATGAGTTATTTTTCTCGGCTGGTCAAAGCCATTTTTTAGTTCCTGGTGGAATAGCATTTTCAACTATGGCGCTCT
ATGGAACCACCTTATCCTTCAATGTGAGTTGCCCATTTTCTTTTAATCTAAAAGTTCAGTTATTTAATATTTTGTGGAATTTGTTAGTCTCTTGCTTTGGTTCTTGGCATATTACTATAT
GAGAGCATTTGTATGTTGATCAATGACATGTTGGATGAGAATTCTAGGATTGAATCTGGATTTAATTTATCTACTTCAAAAAGAATTTTGGAAGAAAAAAAAAAAGGCTTTCTCAATGGC
CGCATGTCCGCTTGGATTGATTGCTAACTCTGTTAGAAGCTGGTATATTATATTTATATATGCTTATAATTTCCATTGCTTGGTTGTAAATAAGAAAACCTTGAATTTAGCTGAAGAAAA
TCGACTTCATGGATTTCTGAGGAGTGAGGAGTGAGAAATGAGGATAAAGTTATACTTTTCCTCTCAATGCTTCTGTATATTTTTTTTTATTTGTTTAGTAGATTTTCTCCCTTGCAAGAC
AGTGCATTGATTTTAACTTTTTAATGAAGGGAATTTCTTCTACTACCAAGGAGTTTAATATCTTACCATGCTCATTCACCAGTAGCTTTCGGAAGCTACATCATGTTTGTCTACCTTCCT
TTACTCCAAACAGATTAGTTTTGGGCAAAAGCTTTGGAAGAGGAGACCAACTGTGTCTTTTACCTGGTCATATTTCAAAGTTGCAAATGGGAAGATTGAGTAAGTATCTATACTTAGATT
TTGCTTGAGTTAAATTCTTTTTGCATCTATGACCCAATTTTGCAGTACTTATTTTTTTGCTAAATTGTGTTTCATTGTCTAAAAATGCCTTTGGTTTCTATCAGGACTGGGAGTAAAAAG
TGAAGACTCTGAGAGCATATTGAGTAGCGACAACATTGCATTGGATGAGCAGACATTGGAGGAGGAGCTACAGAATGCCATAGCTGAAGAGAATTATGCTAAGGCAGCAGAAATAAGGGA
TACTCTGAAAAACCTTCAGAAAGATAGCAAGACAACAGTGTTTGGAGCGAACAGCCGGTTTTACGAATCATTCAGGACTGGTGACCTTGCAGCCATGCAAACCCTGTGGGCAAAAAGCGA
TGAGGTATGCTGTGTCCACCCTGGTTTGAGAGGAATATCTGGTTACAATGATGTTATCGAGAGCTGGAATTTTGTATGGGCTAACTATGAATTTCCACTAAAAATTAAGCTACAAGACAT
TAAGGTTCATGCTAGAGGGGATATGGGGTATGTCACTTGCATGGAATTTGTAAAGACGAAAGGGGGCAGATGGGGAGGTCAATTTGTAACAAATGTGTTTGAGAAGATTGATGGACAGTG
GTTTATTTGTATCCATCATGCTTCACCAGTAGACTTGTAAATACATCAAACTTTTCAATATAGATAGGAGGTTCACTCTGTAGCTCATCGTTGGTCCTTCTCACTTTCTATGTTTGTACC
CATTTTTGTTATGTTTGGGGCCGAATCTCCACTCATCTCCAAAGATTCTTTATGAATTTAACATTACAACTTGATTGTACAACAAATAATCTGTGGAAGTTGAGATGTGGATTAATGAAT
ATATGATAAACTGCCTGAAGTCTCAGGTAAACCGTATGTATATGCGTAGGATTTATCTAGTCCCAACTTTTGTTTTTAAACTCTAGAATATTGAGTTGTAAACTCTGAAGTAAATACATG
TAACCAAGAAACGAAATGTTAACCCTAGTATCCAGGCCTTAAATTTCAAAGATGCTAGTATGGTCAGCGACTCAGTGATGAGTTGCTGCAAAATATCCTATTGCATTTTCATTTCCTAAC
AGTTTCCTTGCCTACTCTATGGTTCCATTTGGGTAAACTACTTTAGTATTTATTTAATAAGTATTTATCATGTAAAGAACTTATGTGTAAGTTGTTTTTATAATTGAAGTAAATATATAG
TTAAACTGTTTTCATGGAAACTGTAAGCTATTTTCGTGTGTTATTCTGGAGAACTTGTTAAAATAAGCTGAAAACCGCTTATGGACATATTATAAGTTATTTTTAAAAGCTCTTGTAATT
ACAAGTGTTTACATCATACGAAAAAGTTTAAATAAGCTATTTTGGAGTCTCTTCTATTAGTTGAACTCTGGTTAGCAACGGTGATTCCCCGTCTGATTCCTTAAACCATATCAAACACCA
TTAATCAGTGATATCAAGATGTCCTAATCATATTCATAAGCTGGGAATAAACCATCTCTTCCAAATAGGAAATAATTGAACGAATAAAGTAAACAGTGCCTTTTTCCCATTAATTTCAAG
TAAAAATATTTGGTTTCATAAATAAACATTGAATTCTAAATATAAACTCGTGTTTTACAAAAGAAAAAAATATACAGTTGAATCTATTGTGTGACATCCAATAGCAGATCTTGTTAAAAA
TATACAAAAAAAAAAAGTAATGAATATAGTGAGTACAAATTAGCCGAGTTTGAGCATTTAGTCTTAAGATTTAAAGTTCTCTGTTAATCCTGACTTCATAAAATGGTATTGATTTCAGTA
TTTTTAAGTATAAAACGACAAAAAACAAATGAAAAAAAAAATGTTTACAATGAATGACTAATTTTAGATATTTAAGCTTAGAGTAAACGTTATCAACTCATTCTCAATGACAAATTTGCG
AGTTCACATTTTTTGGTATTGATACTCAAGACTTGAACTTGAGACTAGAAATTAAGTTGGAACAATATGTGCTACTTGATCCATGTTCTGAGAGGTAGTAACATATACTTGATCATCCCC
ATGTCAATAATGTTCAGTGAGTTGCCAAGAGGATTTCTGATTTTATAGTTTCAGTTCTCTTTTTAAAGAGTTCAACCACTGCAGAGGATAACCCTGCTGGTATTATTCACTGAGGTTTCG
TTTTGTACAAAGATGGTGTTGCTGCAGTGATTTCTTTTGTACAATGATTACGATAATACAACGACCATCCCAGTTTCTGCCACAACATTCCAGTGGAATGGACCTTTTTTGTCTATTTTC
TATACTGGATTGCATGTATGAAAGAAAAACAGAAGAAAATAGAGTAAAAAATGTTACTCCTAGACTTGATTTTCTACACTTCCATTTTACGCTCACCTTTTACACTAAATAGAGGGAGAG
AAAATCACATTTTCCCTTTTGTTATTTTTTTTTTCCCTCTATCCCCTTTTCAAATAAAAGGTAGGTGTAAAATGAAAGTGTAAAAATTCAAGAGCAAGAGTAACATTTATGACAATTGCA
TTTGCATTGCTATTTCTCAGCTACTTGAAGATCTTAAAAGCTAATAGTGATAACTATGAGGTATGAACAACAAAAAAGAAAACTTCTTGTGAGTTTAAACTCTGCCGACAGGGGATAGTG
GAGGCATTGGAGCATATTTTAAAGGTGCTTTCCCCTGAAGTTTTCTGTTGTTCTTGGAACTGGGTTCCTTAAGGTTAAGGATCTCTTCATGCATGTTACCAATTTCCAAGGAACCTGGTA
GTTTCTGGCAGCTTAAAGCCGCAACTGAAATGAAAAATGCCTGTAAATGAGTGATTGTTGAGTCGAATTCAACCGAGTAGAAACCATCCTTCAGTGGCAACAAAGTGAAAAGTGGTTTTT
CTTGCTCAGCTCCTTCCTGAAAGCAATGATAAGGATGATGATATGTAAACGAGAAGTCCACAATATTTATAATTGTATACAAGCACGCTCTCATGTAGAACTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TAGACTTGGAAGAATGGATTCCAAAATTGCCCACTTCACTGTTGCTAACACTGGTGTTATTCCACCTCCCACATCTAACCTCACCAACCTTATGACAAGGTTTCGAGATCAAGGACNNTC
TGCTACGGACATG
GTTTCACTTGCAGGAGCTCACACATTTGGCAAAGGAAGGTGTACTAGTTTCGGATATTGCATATACAATCAAACCAACAATGACAAAACTTTTGCATTGACCAGGCA
GAGGAGGTGTCCTAGGACTAATGGCACAGGTGACAACAATCTAGAAAATTTAGACTTAAGAACTCCAAATCATTTTGACAACAACTATTTCAAAAACCTTCTGATTGAAAGGGGACTCCT
CAATTCTAATCAAGTGTTTTTCAATGGTGGATCCACAGATTCACTAATCAAAATTTATAGCCAGAATAACAAGGCATTTGAT
AGCTCCTTCCTGAAAGCAATGATAAGGATGATGATATG
TAAACGAGAAGTCCACAATATTTATAATTGTATACAAGCACGCTCTCATGTAGAACTATAA

Retrieve as FASTA