Entry information : GmAPx[P]17
Entry ID 9674
Creation 2011-10-06 (Qiang Li (Scipio))
Last sequence changes 2011-11-10 (Qiang Li (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmAPx[P]17
Name GmAPx[P]17
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx[P]17
start..stop
S start..stop
GmAPx[P]22 74 9e-21 1..43 5..47
GmAPx[P]16 76 1e-20 1..43 58..100
GmAPx01 78 3e-20 1..42 79..120
GmAPx26 78 3e-20 1..42 79..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 36688292..36688351 60 N° 2 36688117..36688188 72  
complement(join(36688117..36688188,36688292..36688351))


exon

Literature and cross-references GmAPx[P]17
DNA ref. Phytozome 12:   Gm17 (36688351..36688117)
Protein sequence: GmAPx[P]17
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   43
PWM (Da):   %s   4807.51  
PI (pH):   %s   4.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RLLEPLNAEFPILSYADFYQLPGIVAVEVTGRPEVPFHPEREV*

Retrieve as FASTA  
Remarks Pseudogene from genomic. Incorrect prediction from phytozome. Just short PS.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGCTTTTGGAGCCACTCAATGCGGAGTTTCCTATTTTGAGCTACGCCGATTTCTACCAAGTGATGATTTTTTTCCGATTTTTTAGTTTTTTTTAGATATGAGAATTTGTTGTTACTTGT
CTTTGGTGTTTATGCGCTTATTATGTGTTTGTGTTGAACGTAGTTGCCTGGCATTGTTGCGGTTGAGGTAACTGGTAGACCTGAAGTTCCCTTCCATCCTGAAAGAGAGGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGCTTTTGGAGCCACTCAATGCGGAGTTTCCTATTTTGAGCTACGCCGATTTCTACCAATTGCCTGGCATTGTTGCGGTTGAGGTAACTGGTAGACCTGAAGTTCCCTTCCATCCTGAA
AGAGAGGTATAA

Retrieve as FASTA