Entry information : GmAPx[P]19
Entry ID 9676
Creation 2011-11-10 (Qiang Li (Scipio))
Last sequence changes 2011-12-14 (Qiang Li (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmAPx[P]19
Name GmAPx[P]19
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx[P]19
start..stop
S start..stop
GmAPx[P]16 192 9e-66 1..100 1..100
GmAPx[P]12 183 3e-62 1..100 1..100
GmAPx[P]21 179 7e-61 1..100 1..100
GmAPx01 155 3e-49 1..99 5..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11371300..11371401 102 N° 2 11371506..11371632 127 N° 3 11371691..11371762 72  
join(11371300..11371401,11371506..11371632,11371691..11371762)


exon

Literature and cross-references GmAPx[P]19
DNA ref. Phytozome 12:   Gm10 (11371300..11371762)
Protein sequence: GmAPx[P]19
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   100
PWM (Da):   %s   10870.72  
PI (pH):   %s   8.49
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
YRLVFPLCQKDVEKAKKLRGFIAEKRCAPLMLCLIWHSAGTFDKGTNTGGPFxDIAIRLLEPLKAEFPILSYADFYPLAGVVAVEIMGGPEVPFHPGREV

Retrieve as FASTA  
Remarks Pseudogene from genomic. Just short PS with gaps in it. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACCGTTTGGTTTTTCCCCTTTGTCAGAAGGATGTTGAGAAGGCGAAGAAGCTCAGAGGCTTCATCGCTGAGAAGAGATGTGCTCCTTTAATGCTCTGTTTGGTGTGCGTTCTTTTTTAT
TTTTTTTTATTTAACATTAGATCACTGTTATTTACAATTGAGTTTATGGATTATCGTTTTGACGCGTTTTGGTGTGTTTCGTGTGCATATGGCACTCTGCTGGAACCTTTGACAAGGGCA
CAAACACCGGTGGACCCTTCCNNGACATCGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACC
CAGTGATGTTTTTTTGTCTTTGGTGTT
TGTGCGCTTAATGTTGTGTTTGTGTTGACGCAGTTGGCTGGCGTTGTTGCCGTTGAGATCATGGGTGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TACCGTTTGGTTTTTCCCCTTTGTCAGAAGGATGTTGAGAAGGCGAAGAAGCTCAGAGGCTTCATCGCTGAGAAGAGATGTGCTCCTTTAATGCTCTGTTTGATATGGCACTCTGCTGGA
ACCTTTGACAAGGGCACAAACACCGGTGGACCCTTCCNNGACATCGCTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTACGCCGATTTCTACC
AGTTGGCTGGC
GTTGTTGCCGTTGAGATCATGGGTGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTAT

Retrieve as FASTA