Entry information : BgGPx01 (Gpx1)
Entry ID 9679
Creation 2011-11-10 (Passaia Gisèle)
Last sequence changes 2011-11-10 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-11-14 (Christophe Dunand)
Peroxidase information: BgGPx01 (Gpx1)
Name (synonym) BgGPx01 (Gpx1)
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Erysiphaceae Blumeria
Organism Blumeria graminis    [TaxId: 34373 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BgGPx01
start..stop
S start..stop
CgGPx01 256 3e-88 1..167 70..236
AbenGPx01 251 3e-87 1..167 1..167
TtoGPx01 251 4e-87 1..167 1..167
TeqGPx01 251 4e-87 1..167 1..167
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28..70 43 N° 2 185..414 230 N° 3 498..728 231  
join(28..70,185..414,498..728)


exon

Literature and cross-references BgGPx01 (Gpx1)
Literature Zhang Z, Henderson C, Gurr SJ. Blumeria graminis secretes an extracellular catalase during infection of barley: potential role in suppression of host defence. Mol Plant Pathol. 2004 (6):537-47.
Protein ref. GenBank:   AAL56984.1
DNA ref. GenBank:   AF327337.1
Protein sequence: BgGPx01 (Gpx1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18560.35  
PI (pH):   %s   8.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGPTTTLYDFMPKDKNGEPVPLEKYKGQVVLIVNTASKCGFTPQFEGLEKLYKSVSSTHPGKFTILGFPCNQFGGHDPGSNDEIQNFCRIYGVTFPMLGKVNVNGDTADPLFEWLKVEKPGIMGMKRVKWNFEKWLVSKDGKPIKRYSSTAGPEGFQSLIIEEIEK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACCGACAACTACTCTATACGATTTTATGCCAAAAGATAGTAAGAAGCCAACTTCATATCTGCATGTAGTATCCGTCATACTCGATGTCCGGATAATCTGGAGGCAGAAAGCAAGC
AAACGATTGGAGACGCCCGCTAACATGAAGTGAACAGAGAATGGCGAACCAGTTCCACTTGAAAAGTACAAAGGTCAAGTAGTCTTAATTGTGAATACGGCATCGAAATGTGGCTTCACT
CCTCAGTTTGAGGGCCTAGAAAAGTTATACAAGTCAGTTTCGTCAACACACCCGGGGAAATTCACGATTCTGGGTTTCCCTTGCAACCAATTCGGCGGACACGATCCAGGATCAAATGAT
GAGATTCAGAACTTCTGTCGCATCAAT
GTGAGTCTAGCTTTTTCTGCTGTCGAGCTCTATCCAGCCACGCATATCGTTGCAAACGCTGACGAGATCACTCGCGTTGACAGTATGGCGTCA
CCTTTCCCATGCTGGGCAAAGTTAACGTGAATGGCGATACGGCAGATCCGCTCTTTGAGTGGCTCAAAGTGGAGAAACCTGGCATAATGGGAATGAAGAGGGTCAAGTGGAATTTTGAAA
AGTGGCTCGTGTCAAAAGATGGTAAGCCCATCAAGAGATATTCAAGTACCGCAGGCCCCGAAGGCTTTCAAAGTCTTATAATTGAAGAGATTGAGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGACCGACAACTACTCTATACGATTTTATGCCAAAAGATAAGAATGGCGAACCAGTTCCACTTGAAAAGTACAAAGGTCAAGTAGTCTTAATTGTGAATACGGCATCGAAATGTGGC
TTCACTCCTCAGTTTGAGGGCCTAGAAAAGTTATACAAGTCAGTTTCGTCAACACACCCGGGGAAATTCACGATTCTGGGTTTCCCTTGCAACCAATTCGGCGGACACGATCCAGGATCA
AATGATGAGATTCAGAACTTCTGTCGCATCAAT
TATGGCGTCACCTTTCCCATGCTGGGCAAAGTTAACGTGAATGGCGATACGGCAGATCCGCTCTTTGAGTGGCTCAAAGTGGAGAAA
CCTGGCATAATGGGAATGAAGAGGGTCAAGTGGAATTTTGAAAAGTGGCTCGTGTCAAAAGATGGTAAGCCCATCAAGAGATATTCAAGTACCGCAGGCCCCGAAGGCTTTCAAAGTCTT
ATAATTGAAGAGATTGAGAAGTAG

Retrieve as FASTA