Entry information : CgGPx01
Entry ID 9680
Creation 2011-11-10 (Passaia Gisèle)
Last sequence changes 2011-11-14 (Christophe Dunand)
Sequence status complete
Reviewer Passaia Gisèle
Last annotation changes 2012-04-24 (Catherine Mathe (Scipio))
Peroxidase information: CgGPx01
Name CgGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Chaetomiaceae Chaetomium
Organism Chaetomium globosum    [TaxId: 38033 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgGPx01
start..stop
S start..stop
StheGPx01 343 2e-121 1..236 1..237
TterGPx01 325 3e-114 10..236 5..232
DescGPx01 299 2e-103 60..237 70..256
MacrGPx01 298 2e-103 28..236 28..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 954787..955036 250 N° 2 955126..955586 461  
join(954787..955036,955126..955586)


exon

Literature and cross-references CgGPx01
Protein ref. GenBank:   XP_001228946.1 [Incorrect prediction]
DNA ref. JGI genome:   scaffold_2 (954787..955586)
mRNA ref. GenBank:   XM_001228945.1 [Fragment]
Protein sequence: CgGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   26346.65  
PI (pH):   %s   9.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLSTSSMPISRRLVTRLPYICTSTTRLSISTTSYSLRHLHSSPSQRLGFTPTITPLNHQLPLRRSFATMASATTFYDFKPLDKTGAEVPLEDYKGKVVLVVNTASKCGFTPQFAGLEKLWKSVREQHPDDFVILGFPCNQFGGQDPGTNEEIQEFCQINYGVTFPVLGKVDVNGDNASPVFEWLKAEKPGLLGMKRVKWNFEKFLVSKDGAVKRRWASTTKPESLESVILAELAK

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold_2, 1 intron)1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCTCGACATCATCCATGCCCATCTCCCGCCGGCTGGTAACTCGCCTTCCGTACATTTGCACATCGACAACAAGACTATCAATATCAACTACGTCATACAGTTTACGCCATTTG
CACTCGTCGCCTTCACAGCGCCTCGGATTCACACCCACCATTACCCCTTTGAACCACCAGCTCCCCCTCCGTAGATCATTCGCAACCATGGCTTCCGCTACAACCTTCTACGACTTCAAG
CCCCTCGACA
GTATGTGATTCCCTTTCACTGAACTGATTTCACACCATCTCCCAAACACGCCACCCACTAACCCTGCCCCCCCCCCCCCCCCCCACCAGAAACCGGCGCCGAGGTCCCCC
TCGAGGACTACAAGGGCAAGGTCGTCCTCGTCGTCAACACGGCCTCCAAGTGCGGCTTCACCCCGCAGTTCGCCGGCCTGGAGAAGCTGTGGAAGTCGGTGCGGGAGCAACACCCGGACG
ACTTTGTCATCCTGGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGACCCCGGCACCAACGAGGAGATCCAAGAGTTCTGCCAGATCAACTACGGCGTCACCTTCCCCGTCCTCGGTAAGG
TCGACGTCAACGGCGACAACGCCAGCCCCGTCTTTGAGTGGCTCAAGGCGGAGAAGCCCGGTCTGCTGGGCATGAAGCGGGTCAAGTGGAACTTTGAGAAGTTTCTGGTGAGCAAGGATG
GTGCCGTGAAGAGGCGCTGGGCGTCAACTACGAAGCCGGAGTCGCTGGAGAGTGTGATCCTGGCTGAGTTGGCTAAGCAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTCTCTCGACATCATCCATGCCCATCTCCCGCCGGCTGGTAACTCGCCTTCCGTACATTTGCACATCGACAACAAGACTATCAATATCAACTACGTCATACAGTTTACGCCATTTG
CACTCGTCGCCTTCACAGCGCCTCGGATTCACACCCACCATTACCCCTTTGAACCACCAGCTCCCCCTCCGTAGATCATTCGCAACCATGGCTTCCGCTACAACCTTCTACGACTTCAAG
CCCCTCGACA
AAACCGGCGCCGAGGTCCCCCTCGAGGACTACAAGGGCAAGGTCGTCCTCGTCGTCAACACGGCCTCCAAGTGCGGCTTCACCCCGCAGTTCGCCGGCCTGGAGAAGCTG
TGGAAGTCGGTGCGGGAGCAACACCCGGACGACTTTGTCATCCTGGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGACCCCGGCACCAACGAGGAGATCCAAGAGTTCTGCCAGATCAAC
TACGGCGTCACCTTCCCCGTCCTCGGTAAGGTCGACGTCAACGGCGACAACGCCAGCCCCGTCTTTGAGTGGCTCAAGGCGGAGAAGCCCGGTCTGCTGGGCATGAAGCGGGTCAAGTGG
AACTTTGAGAAGTTTCTGGTGAGCAAGGATGGTGCCGTGAAGAGGCGCTGGGCGTCAACTACGAAGCCGGAGTCGCTGGAGAGTGTGATCCTGGCTGAGTTGGCTAAGCAG

Retrieve as FASTA