Entry information : CgraGPx01
Entry ID 9681
Creation 2011-11-10 (Passaia Gisèle)
Last sequence changes 2011-11-14 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-03-08 (Christophe Dunand)
Peroxidase information: CgraGPx01
Name CgraGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum graminicola (Glomerella graminicola)    [TaxId: 31870 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CgraGPx01
start..stop
S start..stop
ChigGPx01 415 1e-149 1..236 1..240
CfioGPx01_MH18 391 3e-140 1..236 1..241
CgloGPx01_ST23 342 7e-122 69..236 1..168
VaaGPx01 323 5e-113 23..233 43..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 411397..411643 247 N° 2 411755..412218 464  
join(411397..411643,411755..412218)


exon

Literature and cross-references CgraGPx01
DNA ref. GenBank:   ACOD01000058.1 (411397..412218)
EST ref. GenBank:   FE741948.1 [5' end]   FE742228.1 [3' end]
Protein sequence: CgraGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   26549.78  
PI (pH):   %s   9.82
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFRRLHTRAPPSPITTAASVSVHPRHRLPYNLLKTRASPTRSLLIDNKLQLRSTIAANTNKQLHTTAAMASATSFYDFKPLDKRGQEVPLADYKGKVVLVVNTASKCGFTPQYAGLEKLYKDIKEKHGDDFVILGFPCNQFGGQEPGSDDDIQNFCQVNYGVSFPIMQKTDVNGDDANPLFQWLKDEKPGIMGLKRIKWNFEKFLIGRDGKVKGRWASTTKPESLEKPILEELENK

Retrieve as FASTA  
Remarks Complete sequence from genomic (Supercontig 9, 1 intron) and 2 ESTs. Strain="M1.001"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCGTCGGTTACATACCAGAGCCCCTCCTTCTCCCATAACAACCGCCGCTTCCGTATCTGTGCATCCGCGACATCGCCTTCCCTACAACTTACTCAAGACTCGAGCATCACCAACG
CGATCGCTTCTTATTGACAACAAGCTCCAATTACGGAGTACCATCGCCGCAAACACGAACAAGCAGCTCCACACAACCGCAGCAATGGCATCGGCAACTAGCTTCTACGACTTCAAGCCC
CTGGACA
GTATGTGATGCCTCGTATCCTCCCCCCTAGCCTCCCTTCCTCCTCTCTCTCCGTGCATGCACGCCATCTCCCCGCAGTCGCGTCCCCGTCGCTGACACTCGTGCCGCACAGAG
CGCGGTCAGGAGGTCCCCCTCGCCGACTACAAGGGCAAGGTCGTCCTCGTCGTCAACACGGCCTCCAAGTGCGGTTTCACGCCCCAATATGCCGGCCTCGAGAAGCTCTACAAGGACATC
AAGGAGAAGCACGGCGACGACTTTGTCATCCTCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGAGCCCGGCTCCGACGACGACATCCAGAACTTCTGCCAGGTCAATTACGGCGTCTCC
TTCCCCATCATGCAGAAGACGGATGTCAACGGCGACGACGCAAACCCTCTCTTCCAGTGGCTCAAGGATGAGAAGCCCGGCATCATGGGCCTCAAGCGCATCAAGTGGAACTTTGAAAAG
TTCCTCATCGGCCGCGACGGCAAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGTCCCTCGAGAAGCCCATCCTCGAGGAGCTGGAGAACAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCGTCGGTTACATACCAGAGCCCCTCCTTCTCCCATAACAACCGCCGCTTCCGTATCTGTGCATCCGCGACATCGCCTTCCCTACAACTTACTCAAGACTCGAGCATCACCAACG
CGATCGCTTCTTATTGACAACAAGCTCCAATTACGGAGTACCATCGCCGCAAACACGAACAAGCAGCTCCACACAACCGCAGCAATGGCATCGGCAACTAGCTTCTACGACTTCAAGCCC
CTGGACA
AGCGCGGTCAGGAGGTCCCCCTCGCCGACTACAAGGGCAAGGTCGTCCTCGTCGTCAACACGGCCTCCAAGTGCGGTTTCACGCCCCAATATGCCGGCCTCGAGAAGCTCTAC
AAGGACATCAAGGAGAAGCACGGCGACGACTTTGTCATCCTCGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGAGCCCGGCTCCGACGACGACATCCAGAACTTCTGCCAGGTCAATTAC
GGCGTCTCCTTCCCCATCATGCAGAAGACGGATGTCAACGGCGACGACGCAAACCCTCTCTTCCAGTGGCTCAAGGATGAGAAGCCCGGCATCATGGGCCTCAAGCGCATCAAGTGGAAC
TTTGAAAAGTTCCTCATCGGCCGCGACGGCAAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGTCCCTCGAGAAGCCCATCCTCGAGGAGCTGGAGAACAAATAA

Retrieve as FASTA