Entry information : CparGPx01
Entry ID 9682
Creation 2011-11-11 (Passaia Gisèle)
Last sequence changes 2011-11-11 (Passaia Gisèle)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: CparGPx01
Name CparGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Cryphonectriaceae Cryphonectria
Organism Cryphonectria parasitica    [TaxId: 5116 ]
Cellular localisation N/D
Tissue type N/D
Inducer Oxidative stress
Repressor N/D
Best BLASTp hits
Perox score E-value CparGPx01
start..stop
S start..stop
CgraGPx01 295 2e-103 1..168 69..236
ChigGPx01 295 2e-103 1..168 73..240
CfioGPx01_MH18 294 4e-103 1..165 74..238
CgloGPx01_ST23 291 5e-103 1..168 1..168
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5340849..5340891 43 N° 2 5341196..5341662 467  
join(5340849..5340891,5341196..5341662)


exon

Literature and cross-references CparGPx01
Protein ref. JGI genome:   96955
DNA ref. JGI genome:   scaffold_1 (5340849..5341662)
EST ref. GenBank:   GR389078.1
Protein sequence: CparGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   19019.66  
PI (pH):   %s   8.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYDFKVPDKKGEEKPLSEYKGKVVLVVNTASKCGFTPQYAGLEKLWKDIKEKHPDDFVILGFPCNQFGGQEPGTNDDIQSFCQVNYGVSFPIMGKIDVNGDGASDLYKWLKKEKPGIMGIQMVKWNFEKFLIGRDGTVKGRWASTTKPESLEKPILDEIAIKP

Retrieve as FASTA  
Remarks complete sequence from genomic (scaffold_1, 1 intron) and 8 ESTs. Strain "EP155"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCAGCAACCAGCTTTTACGACTTCAAGGTCCCTGACAGTAAGCACCATCCTCCAGACCTGAACCACAGCTTGCCTCGCCCTCGCCTCTACATTGCTACGGCGTCGAGCTGGAAC
ACCGCTGTCCTTCCTCATTCGCACCTCGCTTTGCCCCGTCCCTCTCTTCCACCTGCCTTTCTCGTCCCTGCGCGCAGACGAGTGAACCACCAGATCTTCAGCAGCAACCCATGTTTCTTC
TGCCCCTCCCCGTCCAGATTTCATCACCAGACGCCCCAGACAAGTGGTGGCGAATTGGGTACCAGCTGTGTACATGTGTGGCTAACAGATACAACCTCACTCCACAGAGAAGGGCGAGGA
GAAGCCCCTGTCCGAGTACAAGGGCAAGGTCGTGCTCGTCGTCAACACCGCCTCCAAGTGCGGCTTCACGCCCCAGTACGCGGGGCTCGAGAAGCTCTGGAAGGACATCAAGGAGAAGCA
CCCAGACGACTTTGTCATTCTGGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGAGCCCGGCACCAACGACGATATCCAGTCCTTCTGCCAGGTCAACTACGGCGTCTCCTTCCCCATCAT
GGGCAAGATCGACGTCAACGGCGACGGCGCCAGCGATCTGTACAAGTGGCTCAAGAAGGAGAAGCCTGGCATCATGGGCATCCAGATGGTCAAGTGGAACTTTGAGAAATTCCTCATTGG
CCGCGACGGCACCGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCAGAATCGCTCGAGAAGCCCATCCTGGACGAGATCGCCATCAAGCCAGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCAGCAACCAGCTTTTACGACTTCAAGGTCCCTGACAAGAAGGGCGAGGAGAAGCCCCTGTCCGAGTACAAGGGCAAGGTCGTGCTCGTCGTCAACACCGCCTCCAAGTGCGGC
TTCACGCCCCAGTACGCGGGGCTCGAGAAGCTCTGGAAGGACATCAAGGAGAAGCACCCAGACGACTTTGTCATTCTGGGCTTCCCCTGCAACCAGTTCGGCGGCCAGGAGCCCGGCACC
AACGACGATATCCAGTCCTTCTGCCAGGTCAACTACGGCGTCTCCTTCCCCATCATGGGCAAGATCGACGTCAACGGCGACGGCGCCAGCGATCTGTACAAGTGGCTCAAGAAGGAGAAG
CCTGGCATCATGGGCATCCAGATGGTCAAGTGGAACTTTGAGAAATTCCTCATTGGCCGCGACGGCACCGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCAGAATCGCTCGAGAAGCCC
ATCCTGGACGAGATCGCCATCAAGCCAGAG

Retrieve as FASTA