Entry information : GmAPx[P]22
Entry ID 9684
Creation 2011-10-06 (Qiang Li (Scipio))
Last sequence changes 2011-12-14 (Qiang Li (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmAPx[P]22
Name GmAPx[P]22
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmAPx[P]22
start..stop
S start..stop
GmAPx[P]16 94 1e-27 1..47 54..100
GmAPx[P]19 91 1e-26 1..47 54..100
GmAPx[P]12 89 6e-26 1..47 54..100
GmAPx[P]21 87 3e-25 2..47 55..100
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35066145..35066216 72 N° 2 35066993..35067064 72  
join(35066145..35066216,35066993..35067064)


exon

Literature and cross-references GmAPx[P]22
DNA ref. Phytozome 12:   Gm19 (35066145..35067064)
Protein sequence: GmAPx[P]22
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   47
PWM (Da):   %s   4977.64  
PI (pH):   %s   4.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DIGIRLLEPLKAEFPILSYADFYPLAGVVAVEVTGGPEVPFHPGREV*

Retrieve as FASTA  
Remarks Pseudogene from genomic. Only short PS. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACATTGGTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTATGCCGATTTCTACCCGGTGATGATTTTTTTGTCTTTGGTGTTTGTGCGCTTAATGTTGTATTTG
TGTTGACGCAATTGGTTGGCGTTGTTGCCGTTGAGGTCACGGGTGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTATAATATCGCAAGTTTTTAGTTCTCACGGTTGGTCTCTGTT
ATTTGATTTTGTTATGCCTTATTGTATNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGTTCTTCTTGATAATATGCAGTACCAAAATCAATTTGAATCGTTAATGATATGCAGTA
CCAAAATCAATTTGCTGATATAAAATACTTTTAATTTGAATACTAATTTTGCTGATATAGAATACTTTTAATTTTACATGCAGCGAAGAAAAATTTCATCCTGTGATTCAAATTTCTTTT
CTGAATATTGTCATTTTAATTTTGCAGGTTAATATATAATACCTTGGTAGAGTTGTGTTCAACACAAATGACGGGAACTGATTCACACACAACTATGATTGATGGCCTGGGTGTTGCTTG
ATGGGGAGTTTTGCCCCAAAAAGTTTCAATTTTTTAGAACAAGCACATTCATAGGTACTTGAGATTCAATATTTCCCCCCCTAAATTTCAAGTTTTTAATATGTTTAGTCAATGTAGACA
TTAAACCAAATGATATACAGTTCCAAAATTAGAATTTTGGGGATCCTTTTTTATTTGTTATATATGACAATGATGATTTTTTTGCCTTTGGTGTTTGTGCACTTAATGTTGTGTTTGTGT
TGACGCAGTTGGCTGGCGTTGTTGCCGTTGAGGTCACGGGCGGACCTGAAGTTCCATTCCACCCTGGAAGAGAGGTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACATTGGTATTAGGCTTTTGGAGCCACTCAAGGCGGAGTTCCCTATTTTGAGCTATGCCGATTTCTACCCGTTGGCTGGCGTTGTTGCCGTTGAGGTCACGGGCGGACCTGAAGTTCCA
TTCCACCCTGGAAGAGAGGTATAA

Retrieve as FASTA