Entry information : GsppCIIBA06
Entry ID 9688
Creation 2011-11-15 (Christophe Dunand)
Last sequence changes 2011-11-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: GsppCIIBA06
Name GsppCIIBA06
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Ganoderma sp. 10597 SS1    [TaxId: 767862 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GsppCIIBA06
start..stop
S start..stop
DsCIIBA05 590 0 1..358 1..364
ParcCIIBA01 557 0 1..358 1..361
ParcCIIBA02 516 0 21..358 20..363
CuniCIIBA04 506 0 1..358 1..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1267943..1268059 117 N° 2 1268110..1268153 44 N° 3 1268204..1268249 46 N° 4 1268306..1268346 41
N° 5 1268401..1268535 135 N° 6 1268590..1268821 232 N° 7 1268877..1268939 63 N° 8 1269000..1269144 145
N° 9 1269220..1269435 216 N° 10 1269505..1269542 38  
join(1267943..1268059,1268110..1268153,1268204..1268249,1268306..1268346,1268401 ..1268535,1268590..1268821,1268877..1268939,1269000..1269144,1269220..1269435,12 69505..1269542)


exon

Literature and cross-references GsppCIIBA06
DNA ref. JGI genome:   scaffold_9 (1267943..1269542)
Protein sequence: GsppCIIBA06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (340)
PWM (Da):   %s   38061.84 (36136.7)  
PI (pH):   %s   4.94 (4.85) Peptide Signal:   %s   cut: 19 range:19-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSKSLLSLLSLALVVWAAAPPYKTNCGNGHSTSNPKARCCVWFDVLDDIQENLFDDGKCGEEVHESLLTFHDAISFSPTLGGGGADGSIMAFADIETGFHASTGLDEIVERQKPFALKHNVSFGDFIQFAGAVGVSNCGGGPRLQFLAGRSNNSQVAPDGLIPLPEDPIDKILARMQDAGFSPAETVDLLASHSVAAQDHVDTIHGSPFDSTPSDFDAQFFVETMLKGVAFPGNGSNVGEVLSPYPGEMRLQSDFAIARDPRTACEWQSFVTNHDLMVSKFTKAMAKMAVLGQDPRHLTDCSEVIPVPKRAASQVAHLPAGKTLKDIEASCKKTPFPTIKADPGPETSIPPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTCCAAATCCCTGTTGTCTCTTCTTTCCCTCGCCCTTGTTGTCTGGGCTGCTGCTCCCCCGTACAAGACGAACTGTGGCAACGGCCACAGCACGAGCAACCCCAAGGCGCGTGTT
CTCGGTCTGTGTACTGGTACGCTGTACTGACCCATCGGCTTATCTAGTGTTGCGTGTGGTTCGACGTCCTCGATGATATCCAGGAGAATCTGTAAACATGCACCGCTTATTCCAACCCAT
TCCATGCTTACCGTATCATAGATTTGATGATGGCAAATGCGGAGAGGAGGTTCACGAGTCTCTCCGTGTAGGCATTCTGCTCTTTCAGTCCCAAATTGCGTTAGCTCACATCATCGTTCA
TAGTTGACTTTCCACGATGCCATCAGCTTCTCCCCTACGCTCGGGTAAGCCAAGTGCTCTTATCATCCCCCCGCCAATTGTGCTTACCTCCCGCTCAGTGGTGGCGGCGCTGACGGTTCC
ATCATGGCTTTCGCCGACATCGAGACCGGCTTCCACGCCAGTACCGGCCTGGACGAGATCGTTGAGCGGCAGAAGCCCTTTGCGCTCAAGCACAACGTTTCCTTTGGAGATTT
GTACGTC
TCATTTGATGCCCATCCTCGTTTATATCGCTAAATCACCACCCGTAGTATTCAATTCGCGGGCGCCGTGGGTGTTAGCAACTGCGGCGGTGGCCCCCGTCTCCAGTTCCTCGCAGGGCGT
TCCAACAACTCTCAGGTAGCACCGGATGGTCTGATCCCTCTGCCGGAGGATCCCATCGACAAGATTCTGGCCCGCATGCAAGACGCTGGGTTCAGTCCTGCGGAGACCGTCGACCTACTC
GCGTCACACAGCGTCGCGGCCCAGGATCATGTCGACCCT
GTGCGTATATGCATAACCTTCTGTTCGGAAGATGTCCCTAATTACCTTTGCGTAGACTATCCACGGCAGTCCCTTCGACTC
GACTCCCTCCGACTTCGATGCTCAGTTCTTCGTCGAG
GTGAGCGTACCATCCTCCAGAGTCAGGAGACATGAATGCCGATATTATCTTGCCCCGTAGACTATGCTCAAGGGTGTCGCCTT
CCCCGGTAACGGCTCCAACGTTGGCGAGGTACTTTCCCCCTACCCGGGCGAGATGCGCCTTCAATCCGACTTCGCGATCGCCCGCGACCCCCGCACGGCCTGCGAGTGGCAGTCGTTCGT
TA
GTAAGTGTACCTCCGAATCGCAGCCCTTCCCGCGAACCCCATCCACTCGAAACGCTAATGACGCCCCGTCAACAGCGAACCACGATCTAATGGTGAGCAAGTTTACGAAGGCGATGGC
GAAGATGGCCGTGCTCGGCCAGGACCCCCGCCATCTCACCGACTGCTCCGAGGTCATCCCCGTGCCCAAGCGCGCCGCGTCTCAGGTCGCGCACCTCCCCGCCGGCAAGACGCTCAAGGA
CATCGAGGCGTCGTGCAAGAAGACGCCATTCCCGACCATCAAGGCCGACCCCG
GTGAGTCCTTTCCACGCTGATTTGCTTTCTGTGAGTTTGTTGGGTCTGACGATGCGATACCAAATGC
AGGCCCGGAGACGTCGATTCCCCCCGTCCCTCCTTCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTTTCCAAATCCCTGTTGTCTCTTCTTTCCCTCGCCCTTGTTGTCTGGGCTGCTGCTCCCCCGTACAAGACGAACTGTGGCAACGGCCACAGCACGAGCAACCCCAAGGCGCGTTGT
TGCGTGTGGTTCGACGTCCTCGATGATATCCAGGAGAATCT
ATTTGATGATGGCAAATGCGGAGAGGAGGTTCACGAGTCTCTCCGTTTGACTTTCCACGATGCCATCAGCTTCTCCCCT
ACGCTCGG
TGGTGGCGGCGCTGACGGTTCCATCATGGCTTTCGCCGACATCGAGACCGGCTTCCACGCCAGTACCGGCCTGGACGAGATCGTTGAGCGGCAGAAGCCCTTTGCGCTCAAG
CACAACGTTTCCTTTGGAGATTT
TATTCAATTCGCGGGCGCCGTGGGTGTTAGCAACTGCGGCGGTGGCCCCCGTCTCCAGTTCCTCGCAGGGCGTTCCAACAACTCTCAGGTAGCACCG
GATGGTCTGATCCCTCTGCCGGAGGATCCCATCGACAAGATTCTGGCCCGCATGCAAGACGCTGGGTTCAGTCCTGCGGAGACCGTCGACCTACTCGCGTCACACAGCGTCGCGGCCCAG
GATCATGTCGACCCT
ACTATCCACGGCAGTCCCTTCGACTCGACTCCCTCCGACTTCGATGCTCAGTTCTTCGTCGAGACTATGCTCAAGGGTGTCGCCTTCCCCGGTAACGGCTCCAAC
GTTGGCGAGGTACTTTCCCCCTACCCGGGCGAGATGCGCCTTCAATCCGACTTCGCGATCGCCCGCGACCCCCGCACGGCCTGCGAGTGGCAGTCGTTCGTTA
CGAACCACGATCTAATG
GTGAGCAAGTTTACGAAGGCGATGGCGAAGATGGCCGTGCTCGGCCAGGACCCCCGCCATCTCACCGACTGCTCCGAGGTCATCCCCGTGCCCAAGCGCGCCGCGTCTCAGGTCGCGCAC
CTCCCCGCCGGCAAGACGCTCAAGGACATCGAGGCGTCGTGCAAGAAGACGCCATTCCCGACCATCAAGGCCGACCCCG
GCCCGGAGACGTCGATTCCCCCCGTCCCTCCTTCGTAA

Retrieve as FASTA