Entry information : SbPrx30 (Sobic.002G010700.1[2.1] / Sb02g001140[1.4])
Entry ID 969
Creation 2008-11-16 (Christophe Dunand)
Last sequence changes 2008-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx30 (Sobic.002G010700.1[2.1] / Sb02g001140[1.4])
Name (synonym) SbPrx30 (Sobic.002G010700.1[2.1] / Sb02g001140[1.4])
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Seedlings
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx30
start..stop
S start..stop
ZmPrx60 569 0 4..332 3..336
OsPrx98 478 1e-171 26..331 23..329
ZmPrx125 471 4e-169 27..331 16..319
SiPrx125 467 4e-167 30..331 24..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1014206..1014445 240 N° 2 1014533..1014733 201 N° 3 1014845..1015010 166 N° 4 1015444..1015835 392
join(1014206..1014445,1014533..1014733,1014845..1015010,1015444..1015835)


exon

Literature and cross-references SbPrx30 (Sobic.002G010700.1[2.1] / Sb02g001140[1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 12:   chromosome_2 (1014206..1015835)
Protein sequence: SbPrx30 (Sobic.002G010700.1[2.1] / Sb02g001140[1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (305)
PWM (Da):   %s   34346.52 (31807.1) Transmb domain:   %s   i13-30o
PI (pH):   %s   8.65 (8.33) Peptide Signal:   %s   cut: 28 range:28-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MYAGGGGVRRAATALIWVLVLAAAGGGSVVCEAQLRRGYYAGVCPNVESIVRGVVAKKIQQTPATVGATVRLFFHDCFVEGCDASVMVASTANNTAEKDHPINLSLAGDGFDTVIRARAAVDAAPGCRGKVSCADILAMATRDAIALSGGPSYAVELGRLDGLRSTASSVNGRLPAPFFNLDQLNQMFAANGLSQTDMVALSAGHTVGLAHCSTFAGRLRGADATLDAGYAAQLAGWCPAGVDPRVAVAMDPVTPVSFDNQFFRNLQAGKGLLASDQVLHTDTRSRPTVDALARSRVAFDRAFVDAITRLGRVGVKTATARGNVRRDCAVLG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns) and 1 EST
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACGCCGGCGGCGGCGGCGTGAGGCGTGCGGCGACGGCGCTGATCTGGGTACTGGTGCTTGCGGCGGCGGGTGGCGGCAGCGTCGTCTGCGAGGCGCAGCTCCGGCGCGGGTACTAC
GCCGGCGTGTGCCCCAACGTGGAGTCCATCGTCCGCGGCGTGGTGGCCAAGAAGATCCAGCAGACACCCGCCACCGTCGGCGCCACCGTGCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GTACGTATGGCGGTGCGATGACCATGCTGCATGAATCCGTCGATGAACTATATATATATATATATATATATATATATGCAATTGCAGGGCTGCGACGCGTCGGTGATGGTGGCGTCGACG
GCGAACAACACGGCGGAGAAGGACCACCCCATCAACCTGTCCCTGGCCGGCGACGGCTTCGACACGGTGATCAGGGCCAGGGCGGCCGTGGACGCCGCGCCGGGATGCCGCGGCAAGGTG
TCGTGCGCCGACATCCTCGCCATGGCCACCAGGGACGCCATCGCGCTG
GTACGCACGACCGTTTACGTACGGTACACTACATCAGGCCAGTTATTACAAGCTAAAGCTAGCGACATCATG
GAAACTGAATCCGTGCGTGCGTGCGTGTGCATATTGCAGTCGGGCGGTCCGTCGTACGCGGTGGAGCTGGGTCGGCTGGACGGGCTGAGGTCGACGGCGAGCAGCGTCAACGGGAGGCTG
CCGGCGCCCTTCTTCAACCTGGACCAGCTCAACCAGATGTTCGCCGCCAACGGGCTCTCGCAGACCGACATGGTCGCCCTCTCAG
GTACGTTTTCTGGTCTTGCAAGCTACTCATCGATC
TTGAACTCATCGCACGCATTGCACGACCTCAATCATCAGTGCAGTGGTCTCTGCTCACAAATGACGACAAGCACTTTTCTGAATCTGAAAAAGCTACGCCTACCTTGCTTGCTTGCTCAT
GCTTGGCAATTAATCAGACAACCACACCCATGCACGCAACCGTCGCCACTACCTTCCGCCATGCCCAAATCCAGCAGCTCGCACATGATCCAAAGTCCAAACCACACTTCAGTTTCCGGT
TCTGGAAACCTACAAATTGTTCGCTTGTCTTCTAAACCGTATTTTTTCTGTCAACCAGCAATATTTTTCTCTCATAATAAATCAGCGAATAATACTTTTAGCCATGATTTTTCAGAACAA
CGAACAGAAATAGCTCATCTCCTGCACTATGGACGCAGCTGGGCACACGGTGGGTCTGGCGCACTGCAGCACGTTCGCGGGGCGGCTGCGGGGGGCGGACGCGACGCTGGACGCCGGGTA
CGCGGCGCAGCTGGCGGGGTGGTGCCCGGCGGGGGTGGATCCGCGGGTGGCGGTGGCCATGGACCCCGTGACGCCGGTGAGCTTCGACAACCAGTTCTTCCGGAACCTGCAGGCCGGGAA
GGGACTGCTGGCGTCGGACCAGGTGCTGCACACGGACACCAGGTCCAGACCCACCGTCGACGCGCTGGCACGGAGTCGCGTCGCGTTCGACCGAGCCTTCGTCGACGCCATCACCAGGCT
GGGCCGCGTCGGGGTCAAGACGGCGACGGCACGGGGCAACGTCCGCCGCGACTGCGCCGTGCTCGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTACGCCGGCGGCGGCGGCGTGAGGCGTGCGGCGACGGCGCTGATCTGGGTACTGGTGCTTGCGGCGGCGGGTGGCGGCAGCGTCGTCTGCGAGGCGCAGCTCCGGCGCGGGTACTAC
GCCGGCGTGTGCCCCAACGTGGAGTCCATCGTCCGCGGCGTGGTGGCCAAGAAGATCCAGCAGACACCCGCCACCGTCGGCGCCACCGTGCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GGCTGCGACGCGTCGGTGATGGTGGCGTCGACGGCGAACAACACGGCGGAGAAGGACCACCCCATCAACCTGTCCCTGGCCGGCGACGGCTTCGACACGGTGATCAGGGCCAGGGCGGCC
GTGGACGCCGCGCCGGGATGCCGCGGCAAGGTGTCGTGCGCCGACATCCTCGCCATGGCCACCAGGGACGCCATCGCGCTG
TCGGGCGGTCCGTCGTACGCGGTGGAGCTGGGTCGGCTG
GACGGGCTGAGGTCGACGGCGAGCAGCGTCAACGGGAGGCTGCCGGCGCCCTTCTTCAACCTGGACCAGCTCAACCAGATGTTCGCCGCCAACGGGCTCTCGCAGACCGACATGGTCGCC
CTCTCAG
CTGGGCACACGGTGGGTCTGGCGCACTGCAGCACGTTCGCGGGGCGGCTGCGGGGGGCGGACGCGACGCTGGACGCCGGGTACGCGGCGCAGCTGGCGGGGTGGTGCCCGGCG
GGGGTGGATCCGCGGGTGGCGGTGGCCATGGACCCCGTGACGCCGGTGAGCTTCGACAACCAGTTCTTCCGGAACCTGCAGGCCGGGAAGGGACTGCTGGCGTCGGACCAGGTGCTGCAC
ACGGACACCAGGTCCAGACCCACCGTCGACGCGCTGGCACGGAGTCGCGTCGCGTTCGACCGAGCCTTCGTCGACGCCATCACCAGGCTGGGCCGCGTCGGGGTCAAGACGGCGACGGCA
CGGGGCAACGTCCGCCGCGACTGCGCCGTGCTCGGCTGA

Retrieve as FASTA