Entry information : GsppCIIBA04
Entry ID 9691
Creation 2011-11-15 (Christophe Dunand)
Last sequence changes 2011-11-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-22 (Catherine Mathe (Scipio))
Peroxidase information: GsppCIIBA04
Name GsppCIIBA04
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Ganoderma sp. 10597 SS1    [TaxId: 767862 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GsppCIIBA04
start..stop
S start..stop
ParcCIIBA04 572 0 23..358 26..361
GsppCIIBA09 561 0 1..361 1..361
GsppCIIBA08 561 0 1..361 1..361
ParcCIIBA06 559 0 1..361 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 919307..919414 108 N° 2 919209..919252 44 N° 3 919119..919155 37 N° 4 919052..919060 9
N° 5 918937..918995 59 N° 6 918871..918884 14 N° 7 918774..918815 42 N° 8 918646..918724 79
N° 9 918350..918590 241 N° 10 918240..918293 54 N° 11 918035..918179 145 N° 12 917795..917970 176
N° 13 917662..917726 65 N° 14 917586..917598 13  
complement(join(917586..917598,917662..917726,917795..917970,918035..918179,9182 40..918293,918350..918590,918646..918724,918774..918815,918871..918884,918937..9 18995,919052..919060,919119..919155,919209..919252,919307..919414))


exon

Literature and cross-references GsppCIIBA04
DNA ref. JGI genome:   scaffold_3 (919414..917586)
Protein sequence: GsppCIIBA04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   361 (343)
PWM (Da):   %s   37952.47 (36104.4)  
PI (pH):   %s   4.1 (4.05) Peptide Signal:   %s   cut: 19 range:19-361
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFCKTIIALTSLAVLVSGVPMRRATCSNGRTASDATCCVWFDILDDLQQNLFDNGQCGEEVHSLRLTFHDAIGFSPMLTAQGKFGGGGDGSIMAFAQIETNFHANAGVDEIVETQRPFALKHNVSFGDFIQFAGAVGVSNCAGGPRLQFLAGRSNISQPSPDLLVPEPSDSTDTIFARMGDAGFSPNEVVDLLISHTVAAQDHVDASIGTPLDSTPSSFDSQFFVETLLQGTLFPGNGSNVGESQSALRGEFRLFSDNELARDPRTACEWQSFITDHDLMVTKFEEVMAKLATLGQNPAELTDCSEVIPVPANVQLPPPTLPAGQSLADVEACDATPFPAISAAPGPATSVAPVPPS

Retrieve as FASTA  
Remarks Complete sequence from genomic (13 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTGCAAGACTATCATCGCCCTCACCTCCCTCGCTGTCTTGGTTTCCGGCGTGCCAATGCGCCGCGCGACCTGCAGCAACGGTCGCACCGCTTCAGACGCTACTGTATGTTCCCTA
TTCATATACACTTTACGCCAGCACAACTGATCCCCCACACAGTGCTGTGTCTGGTTTGACATCTTGGACGACCTTCAACAGAACCTGTGAGTGTTCAATTCTGCTGTAGCTCCTATATTC
GCATCTCACAGTCCCCCAGGTTCGATAACGGCCAGTGCGGCGAGGAGGTACACGAGGTAAGCACACTACCGTTGCCGGAGGATGCTCTATACATTAACGCTGCTTTCTATCCAGTCCTTG
CGT
GTAAGAGCCATTCTAGCGTTGGTTTTTACCGTCAAGATAATGAGCCCCACATACAGTTGACCTTCCACGACGCCATTGGTTTTTCTCCCATGCTCACGGCCCAGGGAAAGTTTGGGT
GAGTTAGTAGTTAATCGCCGTCCTAAACTTTGCTAACCTACGACTTCTAGCGGTGGAGGAGCTGGTAAGGAGACAGTACAATGTTGTTCTGACTTTGTTCATCATCGTAACCTCTATAGA
CGGATCCATTATGGCTTTCGCTCAGATTGAGACCAACTTCC
GTGAGCACATAATAAAATTGATTGATTTTCTCGGCTAACAACTGCCCAGACGCCAACGCTGGGGTTGACGAGATCGTCG
AGACGCAGCGCCCCTTTGCCCTCAAGCACAACGTTTCTTTCGGCGACTT
GTGAGTTCATTACCCTTCTCCCTCTACTCAAACTTTCTAAAATCTTATCTGATAGCATCCAATTCGCTGGC
GCCGTCGGCGTCTCCAACTGTGCTGGCGGCCCGCGCCTGCAGTTCCTGGCTGGCCGTTCGAACATATCGCAGCCCTCGCCCGATTTGCTGGTCCCCGAGCCATCTGACTCCACGGACACC
ATCTTTGCTCGCATGGGTGATGCCGGCTTCTCGCCGAACGAGGTCGTCGACCTGCTTATCTCTCACACTGTTGCTGCTCAGGACCACGTCGACGCTTCCATCCCC
GTGAGTGCCTCCATA
TGTCTTCCATTGAATACGTCCTCTGATGCTGCTCTGGGTAGGGTACTCCGTTGGACTCGACTCCGAGCTCTTTTGACTCCCAATTCTTCGTCGAGGCGAGTAAATGCCGATTCACATGGT
CAATAAGATTTCTCACCACACTCTCCAACGCGTAGACTCTCTTGCAAGGCACTCTCTTCCCCGGGAACGGCTCCAACGTCGGTGAGTCCCAGTCGGCCCTCCGCGGAGAGTTCCGTCTCT
TCTCGGACAACGAGCTCGCCCGCGACCCACGCACCGCGTGCGAGTGGCAGTCTTTCATCA
GTAAGACCCCCCCTCCCCGAACTAGTATCCGTCTGCCTAACCTGACCCTCCTGGACCGCC
GCAGCCGACCACGACTTGATGGTCACCAAGTTCGAGGAGGTCATGGCCAAGCTCGCGACCCTCGGCCAGAACCCCGCGGAGCTCACCGACTGCTCCGAGGTCATCCCCGTCCCCGCGAAC
GTCCAGCTCCCGCCGCCGACCCTCCCGGCCGGCCAGTCCCTCGCCGACGTCGAGGCTGCG
GTGCGTCCCAGAACAGCCCGATACAGTACATGGCTTCCCTGTCGCTGACCTGCTAATTAA
CGCAACAGTGCGACGCCACCCCCTTCCCGGCGATCAGCGCTGCTCCCGGCCCCGCTACCAGCGTTGCTCCTGTGTAAGTGCACCGACATTCCTCTGACGCATCTCGACCGACGCGTTGCT
GATTTGGTCATTGCAGCCCTCCCTCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTGCAAGACTATCATCGCCCTCACCTCCCTCGCTGTCTTGGTTTCCGGCGTGCCAATGCGCCGCGCGACCTGCAGCAACGGTCGCACCGCTTCAGACGCTACTTGCTGTGTCTGG
TTTGACATCTTGGACGACCTTCAACAGAACCT
GTTCGATAACGGCCAGTGCGGCGAGGAGGTACACGAGTCCTTGCGTTTGACCTTCCACGACGCCATTGGTTTTTCTCCCATGCTCACG
GCCCAGGGAAAGTTTGG
CGGTGGAGGAGCTGACGGATCCATTATGGCTTTCGCTCAGATTGAGACCAACTTCCACGCCAACGCTGGGGTTGACGAGATCGTCGAGACGCAGCGCCCCTTT
GCCCTCAAGCACAACGTTTCTTTCGGCGACTT
CATCCAATTCGCTGGCGCCGTCGGCGTCTCCAACTGTGCTGGCGGCCCGCGCCTGCAGTTCCTGGCTGGCCGTTCGAACATATCGCAG
CCCTCGCCCGATTTGCTGGTCCCCGAGCCATCTGACTCCACGGACACCATCTTTGCTCGCATGGGTGATGCCGGCTTCTCGCCGAACGAGGTCGTCGACCTGCTTATCTCTCACACTGTT
GCTGCTCAGGACCACGTCGACGCTTCCATCCCC
GGTACTCCGTTGGACTCGACTCCGAGCTCTTTTGACTCCCAATTCTTCGTCGAGACTCTCTTGCAAGGCACTCTCTTCCCCGGGAAC
GGCTCCAACGTCGGTGAGTCCCAGTCGGCCCTCCGCGGAGAGTTCCGTCTCTTCTCGGACAACGAGCTCGCCCGCGACCCACGCACCGCGTGCGAGTGGCAGTCTTTCATCA
CCGACCAC
GACTTGATGGTCACCAAGTTCGAGGAGGTCATGGCCAAGCTCGCGACCCTCGGCCAGAACCCCGCGGAGCTCACCGACTGCTCCGAGGTCATCCCCGTCCCCGCGAACGTCCAGCTCCCG
CCGCCGACCCTCCCGGCCGGCCAGTCCCTCGCCGACGTCGAGGCTGCG
TGCGACGCCACCCCCTTCCCGGCGATCAGCGCTGCTCCCGGCCCCGCTACCAGCGTTGCTCCTGTCCCTCCC
TCTTAA

Retrieve as FASTA