Entry information : GsppCIIBB05
Entry ID 9692
Creation 2011-11-15 (Christophe Dunand)
Last sequence changes 2012-12-04 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2017-03-02 (Catherine Mathe)
Peroxidase information: GsppCIIBB05
Name GsppCIIBB05
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Ganoderma sp. 10597 SS1    [TaxId: 767862 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GsppCIIBB05
start..stop
S start..stop
TvCIIBB02_IFO30340 550 0 1..364 1..365
TvCIIBB02 548 0 1..364 1..365
TvCIIBB02_PRL572 548 0 1..364 1..365
TvCIIBB02_KN9522 542 0 1..363 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1449689..1449749 61 N° 2 1449417..1449624 208 N° 3 1449219..1449353 135 N° 4 1449041..1449162 122
N° 5 1448432..1448987 556 N° 6 1448352..1448364 13  
complement(join(1448352..1448364,1448432..1448987,1449041..1449162,1449219..1449 353,1449417..1449624,1449689..1449749))


exon

Literature and cross-references GsppCIIBB05
DNA ref. JGI genome:   scaffold_3 (1449749..1448352)
Protein sequence: GsppCIIBB05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (343)
PWM (Da):   %s   38488.9 (36362.7)  
PI (pH):   %s   4.13 (4.11) Peptide Signal:   %s   cut: 22 range:22-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKALLSIVTLVAALQVADAALTRRVACPDGKNTATNAACCQLFAIADDLQQNLFDNGGCGEDVHESLRLTFHDAIAFSPSMNARGQNGGGGADGSIALFESIETNFHASLGLDEIVNAQRPIVQRHNITTADFIMFAAAVGVANCPGAPQLDVFLGRADATQPSPDGLIPEPDPPDMLLARMADAGFDPIETVWLLSSHTIAAADLVDPTIPGTPFDSTPELFDTQFFIETQLRGTLFPGTGGNQGEVESPLRGEIRLQSDHLLARDSRTACEWQSFVNNQPKIQGRFHDAFHDLSLLGHDINDLIDCSEVIQTPPPPASNAHFPAGLSNADVEQACADTPFPTLPTDPGPVTSVAPVPPS

Retrieve as FASTA  
Remarks complete sequence from genomic (5 introns). Incorrect prediction from JGI (last very short intron is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAGCTCTTCTCTCCATCGTCACCCTCGTGGCGGCCCTTCAGGTCGCAGACGGTGCGGCCGCCCTCCCTCTTCACTTAGTTCGGAGCGCGGGCTCTAACGTATCTGCGCGT
TTTAGCTGCCCTCACGCGCCGCGTCGCGTGCCCAGACGGGAAGAACACTGCAACGAACGCGGCGTGCTGCCAGCTCTTCGCGATTGCGGACGACCTCCAGCAGAACCTCTTCGACAACGG
TGGATGCGGTGAGGACGTGCACGAGTCACTCCGTCTCACTTTCCACGACGCCATCGCCTTCTCTCCCTCGATGAACGCTCGTGGCCAGAACGG
GTCCGTACCACTCGCCTTATTCTTAAC
ACATTGACGTGTCTTGACTATGTCATTGGCTTGTAGCGGTGGAGGTGCCGACGGTTCCATTGCGCTCTTCGAGTCCATCGAGACCAACTTCCACGCGAGCTTGGGGCTCGACGAGATCGT
CAACGCCCAGCGCCCCATCGTCCAGAGGCACAACATCACGACCGCTGACTT
GTACGCGTACCGTTATCATTCTGTTGACGCGCGAGGGCCCTAATGTGAAAACGTAGTATCATGTTCGCG
GCCGCGGTCGGTGTTGCGAACTGCCCTGGTGCGCCCCAGCTTGACGTCTTCCTCGGCCGTGCGGATGCGACCCAGCCCTCTCCTGATGGGCTCATCCCCGAGCCGTTCG
GTACGTAACAT
TCACCTTCATTACCCTTCAGCCAACTCACGAGGCCCTCCCAGACCCCCCTGACATGCTCCTCGCCCGCATGGCTGACGCTGGCTTTGACCCCATCGAGACTGTCTGGCTACTCTCCTCGC
ACACCATCGCCGCGGCAGACCTCGTCGACCCCACGATCCCGGGCACGCCCTTCGACTCGACGCCCGAGCTCTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGTGGCACGCTCTTCC
CCGGCACAGGGGGCAACCAGGGCGAGGTCGAGTCCCCGCTCCGCGGCGAGATCCGTCTCCAGTCGGACCACCTCCTCGCGCGCGACTCGCGCACGGCGTGCGAGTGGCAGTCGTTCGTGA
ACAACCAGCCCAAGATCCAGGGCCGCTTCCACGACGCGTTCCACGACCTCTCGCTCCTCGGCCACGACATCAACGACCTCATCGACTGCTCCGAAGTCATCCAGACCCCGCCCCCGCCCG
CGAGCAACGCGCACTTCCCCGCCGGGCTCTCCAACGCCGATGTCGAGCAGGCGTGTGCCGACACCCCCTTCCCCACCCTCCCGACTGACCCCGGCCCGGTCACCTCGGTCGCCCCCGT
GT
AAGTGACATCCAATCATCGCGGTTGCGTTACGAGAGGGACTGACGGCGGTTGCTTTATAACTTAGCCCCCCGTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAAGCTCTTCTCTCCATCGTCACCCTCGTGGCGGCCCTTCAGGTCGCAGACGCTGCCCTCACGCGCCGCGTCGCGTGCCCAGACGGGAAGAACACTGCAACGAACGCGGCG
TGCTGCCAGCTCTTCGCGATTGCGGACGACCTCCAGCAGAACCTCTTCGACAACGGTGGATGCGGTGAGGACGTGCACGAGTCACTCCGTCTCACTTTCCACGACGCCATCGCCTTCTCT
CCCTCGATGAACGCTCGTGGCCAGAACGG
CGGTGGAGGTGCCGACGGTTCCATTGCGCTCTTCGAGTCCATCGAGACCAACTTCCACGCGAGCTTGGGGCTCGACGAGATCGTCAACGCC
CAGCGCCCCATCGTCCAGAGGCACAACATCACGACCGCTGACTT
TATCATGTTCGCGGCCGCGGTCGGTGTTGCGAACTGCCCTGGTGCGCCCCAGCTTGACGTCTTCCTCGGCCGTGCG
GATGCGACCCAGCCCTCTCCTGATGGGCTCATCCCCGAGCCGTTCG
ACCCCCCTGACATGCTCCTCGCCCGCATGGCTGACGCTGGCTTTGACCCCATCGAGACTGTCTGGCTACTCTCC
TCGCACACCATCGCCGCGGCAGACCTCGTCGACCCCACGATCCCGGGCACGCCCTTCGACTCGACGCCCGAGCTCTTCGACACCCAGTTCTTCATCGAGACCCAGCTCCGTGGCACGCTC
TTCCCCGGCACAGGGGGCAACCAGGGCGAGGTCGAGTCCCCGCTCCGCGGCGAGATCCGTCTCCAGTCGGACCACCTCCTCGCGCGCGACTCGCGCACGGCGTGCGAGTGGCAGTCGTTC
GTGAACAACCAGCCCAAGATCCAGGGCCGCTTCCACGACGCGTTCCACGACCTCTCGCTCCTCGGCCACGACATCAACGACCTCATCGACTGCTCCGAAGTCATCCAGACCCCGCCCCCG
CCCGCGAGCAACGCGCACTTCCCCGCCGGGCTCTCCAACGCCGATGTCGAGCAGGCGTGTGCCGACACCCCCTTCCCCACCCTCCCGACTGACCCCGGCCCGGTCACCTCGGTCGCCCCC
GT
CCCCCCGTCCTAA

Retrieve as FASTA