Entry information : GsppCIIBB07
Entry ID 9694
Creation 2011-11-15 (Christophe Dunand)
Last sequence changes 2012-12-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-04 (Christophe Dunand)
Peroxidase information: GsppCIIBB07
Name GsppCIIBB07
Class Other class II peroxidase type B    [Orthogroup: CIIBB001]
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Ganoderma sp. 10597 SS1    [TaxId: 767862 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GsppCIIBB07
start..stop
S start..stop
TvCIIBB02_IFO30340 580 0 1..365 1..365
TvCIIBB02 580 0 1..365 1..365
TvCIIBB02_PRL572 580 0 1..365 1..365
TvCIIBB02_KN9522 574 0 1..364 1..364
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2506526..2506586 61 N° 2 2506249..2506456 208 N° 3 2506053..2506187 135 N° 4 2505880..2506001 122
N° 5 2505744..2505822 79 N° 6 2505565..2505690 126 N° 7 2505391..2505506 116 N° 8 2505237..2505334 98
N° 9 2505110..2505184 75 N° 10 2504994..2505058 65 N° 11 2504924..2504937 14  
complement(join(2504924..2504937,2504994..2505058,2505110..2505184,2505237..2505 334,2505391..2505506,2505565..2505690,2505744..2505822,2505880..2506001,2506053. .2506187,2506249..2506456,2506526..2506586))


exon

Literature and cross-references GsppCIIBB07
DNA ref. JGI genome:   scaffold_3 (2506586..2504942)
Protein sequence: GsppCIIBB07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   365 (344)
PWM (Da):   %s   38128.72 (36085.6)  
PI (pH):   %s   4.01 (3.97) Peptide Signal:   %s   cut: 22 range:22-365
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKSLASLVSVLAALQAANGGLIRRVTCPDGINMVNNAACCSLFAIRDDIQQNLFDGGECGEDVHESLRLTFHDAIGISPSLMAQGIFGGGGADGSIAIFESIETNFHANLGVDEIVNEQAPFIARHNITPGDFIQFAGAVGVSNCPGAPQLEFLLGRPAATQPAPDKTVPEPDTVDTILARFLDAGNFTSDEVVALLSSHTVAAADRVDPTIPGTPFDSTPELFDTQFFIETQLLGTLFPGTAGNQGEVESPLAGEIRLQSDAELARDSRTACEWQSMNNQAKMMSSFKAAMAKLAVLGQDVSQMVDCSDIPIPPPPMSNAHFPAGLSNADIEQACASTPFPTLPTDPGPVTSVAPVSSX

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). Incorrect prediction from JGI (last ery shor exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAATCCCTCGCATCCTTGGTCTCTGTCCTCGCCGCACTCCAGGCCGCCAACGGTCCGTCCTTGAATCCTTTTATTACGCCGGACAGCATGTCCCTCCCACTTTACTGACGT
CATGTTGCAGGCGGGCTCATCCGCCGTGTTACCTGTCCCGACGGTATCAACATGGTGAACAACGCGGCATGCTGCTCGCTCTTCGCCATCCGCGACGACATCCAGCAGAACCTGTTCGAT
GGCGGCGAGTGCGGCGAGGACGTTCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATCGGTATTTCACCATCCCTCATGGCCCAAGGCATCTTCGG
GTGAGGGCTGTCGGGTCCTTGT
TTGTTCGTATGCGGCATGCTCACTTGTATTCGTTCCCAGCGGCGGAGGTGCCGACGGCTCGATCGCCATATTCGAGTCCATTGAGACCAACTTCCACGCCAACCTTGGTGTGGATGAGAT
CGTCAACGAACAGGCCCCATTCATCGCCCGCCACAACATCACCCCCGGCGATTT
GTGAGTCAGCGCCCTGTCACGCCCTGACACTCTTCTGACGCATATCTATAGCATTCAATTCGCCGG
AGCTGTCGGGGTGAGCAACTGTCCCGGTGCTCCTCAGCTCGAGTTCCTTCTCGGCCGTCCTGCCGCGACTCAGCCTGCTCCGGACAAAACCGTCCCCGAGCCTTTCG
GTAAGTGCATCGA
CTAGATTCAACAATGCGAAGAGCTCAGTCCTTTACCCCTATCAGACACCGTCGACACCATCCTGGCTAGATTCCTCGACGCGGGCAACTTCACTTCTGATGAGGTTGTCGCCCTTCTGTC
TTC
GTAAGTCTCCTTTAAACAAGAAACATGCCCCTCAGGCTGACGCCTGTATGAAGCCACACAGTTGCCGCGGCCGACCGCGTTGATCCTACTATTCCGGGCACGCCGTTCGACTCCACC
CCTGAGCTCTTCGACACCCAGTTCTTCATTGAGACCCAGCTCCTCGGCACACTGTTCCCTGG
GTATCAAGTCTTCATGTTCGCCCGTCACAAGCATTGTCGCTGACTGATGCGACCACAG

AACCGCCGGTAACCAGGGTGAGGTCGAGTCTCCGCTCGCCGGAGAGATACGTCTCCAGTCCGACGCTGAACTCGCCCGTGACTCTCGGACTGCTTGTGAATGGCAGTCCATGGTTA
GTGC
GTATTCCTGGTTCCCATCGGTTGTAGACAGCCACTGACAGGCGTGGTCACAGACAACCAGGCCAAGATGATGTCGTCGTTCAAGGCCGCCATGGCGAAGCTCGCGGTCCTCGGTCAGGAC
GTGAGCCAGATGGTCGATTGCTCGGATGTG
GTATGTCACACTATCAAGGACGAAGACAGCTGAATCCTCAATGTGCTCGCAGATCCCGATTCCGCCGCCGCCGATGAGCAACGCCCACTT
CCCCGCTGGCTTGTCCAACGCCGACATCGAGCAGGCC
GTACGTGTACATGCACTCCGATGAGGAAATCGCGCTCATATTCCTCTTCAGTGCGCGTCCACGCCCTTCCCCACTCTCCCGAC
CGACCCCGGCCCGGTCACTTCTGTTGCGCCTGT
GTACGTCCTCTCCTCTCTCACCACCACACGGTACTCATTATCTAATGTTTAATATAGTCCTCCGTCCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAATCCCTCGCATCCTTGGTCTCTGTCCTCGCCGCACTCCAGGCCGCCAACGGCGGGCTCATCCGCCGTGTTACCTGTCCCGACGGTATCAACATGGTGAACAACGCGGCA
TGCTGCTCGCTCTTCGCCATCCGCGACGACATCCAGCAGAACCTGTTCGATGGCGGCGAGTGCGGCGAGGACGTTCACGAGTCCCTCCGTCTCACCTTCCACGACGCCATCGGTATTTCA
CCATCCCTCATGGCCCAAGGCATCTTCGG
CGGCGGAGGTGCCGACGGCTCGATCGCCATATTCGAGTCCATTGAGACCAACTTCCACGCCAACCTTGGTGTGGATGAGATCGTCAACGAA
CAGGCCCCATTCATCGCCCGCCACAACATCACCCCCGGCGATTT
CATTCAATTCGCCGGAGCTGTCGGGGTGAGCAACTGTCCCGGTGCTCCTCAGCTCGAGTTCCTTCTCGGCCGTCCT
GCCGCGACTCAGCCTGCTCCGGACAAAACCGTCCCCGAGCCTTTCG
ACACCGTCGACACCATCCTGGCTAGATTCCTCGACGCGGGCAACTTCACTTCTGATGAGGTTGTCGCCCTTCTG
TCTTC
CCACACAGTTGCCGCGGCCGACCGCGTTGATCCTACTATTCCGGGCACGCCGTTCGACTCCACCCCTGAGCTCTTCGACACCCAGTTCTTCATTGAGACCCAGCTCCTCGGCACA
CTGTTCCCTGG
AACCGCCGGTAACCAGGGTGAGGTCGAGTCTCCGCTCGCCGGAGAGATACGTCTCCAGTCCGACGCTGAACTCGCCCGTGACTCTCGGACTGCTTGTGAATGGCAGTCC
ATGGTTA
ACAACCAGGCCAAGATGATGTCGTCGTTCAAGGCCGCCATGGCGAAGCTCGCGGTCCTCGGTCAGGACGTGAGCCAGATGGTCGATTGCTCGGATGTGATCCCGATTCCGCCG
CCGCCGATGAGCAACGCCCACTTCCCCGCTGGCTTGTCCAACGCCGACATCGAGCAGGCC
TGCGCGTCCACGCCCTTCCCCACTCTCCCGACCGACCCCGGCCCGGTCACTTCTGTTGCG
CCTGT
GTCCTCCGTCCTAA

Retrieve as FASTA