Entry information : GsppCIIBA[P]02
Entry ID 9697
Creation 2011-11-15 (Christophe Dunand)
Last sequence changes 2012-03-27 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-15 (Christophe Dunand)
Peroxidase information: GsppCIIBA[P]02
Name GsppCIIBA[P]02
Class Other class II peroxidase type A    [Orthogroup: N/D] N/D
Taxonomy Fungi/Metazoa; Fungi; Basidiomycota; Basidiomycota
Organism Ganoderma sp. 10597 SS1    [TaxId: 767862 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GsppCIIBA[P]02
start..stop
S start..stop
GapCIIBA01 385 2e-134 1..318 1..352
GauCIIBA01 385 2e-134 1..318 1..352
GsppVP01 370 1e-128 1..318 1..352
GfCIIBA01 362 2e-125 1..318 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2795204..2795332 129 N° 2 2795386..2795429 44 N° 3 2795483..2795531 49 N° 4 2795588..2795646 59
N° 5 2795691..2795989 299 N° 6 2796084..2796202 119 N° 7 2796278..2796315 38 N° 8 2796397..2796611 215
join(2795204..2795332,2795386..2795429,2795483..2795531,2795588..2795646,2795691 ..2795989,2796084..2796202,2796278..2796315,2796397..2796611)


exon

Literature and cross-references GsppCIIBA[P]02
DNA ref. JGI genome:   scaffold_3 (2795204..2796611)
Protein sequence: GsppCIIBA[P]02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (292)
PWM (Da):   %s   33291.27 (30633.8) Transmb domain:   %s   i5-24o
PI (pH):   %s   4.28 (4.17) Peptide Signal:   %s   cut: 27 range:27-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFSRVFLSVAVLAVSVLVAVPSAARSKHETVTCNNGKTTTNDACCVWLDVLDDIQENLFHGVQYGEDAHESLRLLTFHDAIGFSQALTAAGQFGWIAAEALVSAASSYASYVDIRHGSIQFAGAVGVTNCNGGFAVRSNDSQPAPPDSGLLSYSVDFIIARFSDAGFSAAGVVQLLLSHTVGAQGKVDPVxVTSFFVETMLNGTLSPSNSLQDGEVLSPYPGEFCLQSDFAIARDSRTACGWQRMIADRAHMLARFEEVMTELSTLGFDRSTLTDCSDVISTSTGTVADPFIPAGLSLDDLQPACSASPFPTAATVAG

Retrieve as FASTA  
Remarks Pseudogene from genomic. Missing motifs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCTAGGGTTTTCCTCTCCGTCGCTGTTCTCGCTGTCTCAGTCCTCGTCGCCGTTCCATCCGCCGCTCGAAGCAAGCATGAGACTGTGACATGCAACAACGGCAAAACTACTACG
AACGATGCG
GTATCCACATCCCTGAAATTCCTACCACACTGCGATCTGACCACTTCGACCAGTGCTGTGTCTGGCTCGACGTCCTGGACGACATCCAAGAGAATCTATAGGTATTGCAAC
TTCTATTGCATGGACCTCCAGCTTATGAGAAAATGTCAGCTTCCACGGCGTACAGTACGGCGAAGATGCTCACGAATCCCTAAGGTTAATATATCTCGATCTAGCCGGTTAATGAAAGAC
AACTGAATGACTTTGCTTTTGTAGCTGACATTCCATGACGCTATCGGTTTCTCCCAAGCTCTGACTGCTGCGGGTCAATTCGGGTGACTCTTGCCGCATCCTCTCTTGCCGGTTACGTGC
TGACTATTTGGATAGCGGCGGAGGCGCTGGTAAGTGCTGCATCCTCGTATGCCTCATATGTTGATATTCGTCATGGCAGCATCCAGTTCGCAGGAGCCGTTGGGGTTACGAACTGCAACG
GTGGTTTCGCCGTTCGTTCCAACGACTCCCAACCGGCCCCTCCGGACTCCGGCCTCCTGTCGTACAGCGTTGACTTTATTATCGCGCGTTTCAGCGATGCGGGCTTCAGCGCTGCGGGGG
TCGTGCAGCTCTTGCTCTCTCACACCGTTGGCGCACAGGGCAAGGTCGACCCAGTGANNGTGACCT
CGGTCTCTATATCTTTCCTCGAGAATGAACGCTTGACGCTGATGCGCCGTTTGT
GTACTACCAGAGCATCGCTCCGTTCGACTCGACGCCTCCCAGTTCTTCGTCGAGACGATGCTGAACGGCACGCTCTCCCCCAGTAACAGCCTCCAAGATGGAGAAGTGCTGTCGCCCTAC
CCTGGCGAGTTCTGCCTCCAGTCCGACTTCGCGATCGCT
CGGTGAGTGGTTCCCCGGAACAGTAAAACTGCGTAACCCCAGTGCCGCCGACGTCGCGCTCACTACCCTCACGACAGCGAC
TCCCGCACGGCCTGCGGGTGGCAAAGGATGAT
CGGTATGTGTCCCCTGTCTTCGTCCCTCGTCCCGCCCCCACGGCGAGACTATGTGACACCGGACTCAACCTGTTTATCTCCAGCGGAC
CGCGCGCACATGCTCGCACGCTTTGAGGAAGTCATGACCGAGCTCTCGACGCTCGGCTTCGACCGTTCCACGCTGACCGACTGCTCCGACGTCATCTCCACCTCGACTGGCACCGTCGCC
GACCCATTCATCCCGGCGGGGCTTTCCTTGGACGACCTCCAGCCTGCCTGCTCGGCGAGCCCCTTCCCCACGGCGGCCACTGTCGCGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCTCTAGGGTTTTCCTCTCCGTCGCTGTTCTCGCTGTCTCAGTCCTCGTCGCCGTTCCATCCGCCGCTCGAAGCAAGCATGAGACTGTGACATGCAACAACGGCAAAACTACTACG
AACGATGCG
TGCTGTGTCTGGCTCGACGTCCTGGACGACATCCAAGAGAATCTCTTCCACGGCGTACAGTACGGCGAAGATGCTCACGAATCCCTAAGGTTACTGACATTCCATGACGCT
ATCGGTTTCTCCCAAGCTCTGACTGCTGCGGGTCAATTCGG
TTGGATAGCGGCGGAGGCGCTGGTAAGTGCTGCATCCTCGTATGCCTCATATGTTGATATTCGTCATGGCAGCATCCAG
TTCGCAGGAGCCGTTGGGGTTACGAACTGCAACGGTGGTTTCGCCGTTCGTTCCAACGACTCCCAACCGGCCCCTCCGGACTCCGGCCTCCTGTCGTACAGCGTTGACTTTATTATCGCG
CGTTTCAGCGATGCGGGCTTCAGCGCTGCGGGGGTCGTGCAGCTCTTGCTCTCTCACACCGTTGGCGCACAGGGCAAGGTCGACCCAGTGANNGTGACCT
AGTTCTTCGTCGAGACGATG
CTGAACGGCACGCTCTCCCCCAGTAACAGCCTCCAAGATGGAGAAGTGCTGTCGCCCTACCCTGGCGAGTTCTGCCTCCAGTCCGACTTCGCGATCGCT
AGCGACTCCCGCACGGCCTGC
GGGTGGCAAAGGATGAT
AGCGGACCGCGCGCACATGCTCGCACGCTTTGAGGAAGTCATGACCGAGCTCTCGACGCTCGGCTTCGACCGTTCCACGCTGACCGACTGCTCCGACGTCATC
TCCACCTCGACTGGCACCGTCGCCGACCCATTCATCCCGGCGGGGCTTTCCTTGGACGACCTCCAGCCTGCCTGCTCGGCGAGCCCCTTCCCCACGGCGGCCACTGTCGCGG

Retrieve as FASTA