Entry information : SbPrx104 (Sobic.007G192300.1 [2.1] / Sb07g026130 [1.4])
Entry ID 970
Creation 2008-11-16 (Christophe Dunand)
Last sequence changes 2008-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-04 (Messaoudi)
Peroxidase information: SbPrx104 (Sobic.007G192300.1 [2.1] / Sb07g026130 [1.4])
Name (synonym) SbPrx104 (Sobic.007G192300.1 [2.1] / Sb07g026130 [1.4])
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue types Roots hairs
Seedlings
Inducer Dark growth
Repressor N/D
Best BLASTp hits
Perox score E-value SbPrx104
start..stop
S start..stop
ZmPrx80 583 0 1..336 1..337
SiPrx64 493 3e-177 1..336 1..333
BdiPrx111 455 3e-162 1..336 1..335
OsPrx119 453 1e-161 1..336 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61317427..61317666 240 N° 2 61319274..61319465 192 N° 3 61319588..61320166 579  
join(61317427..61317666,61319274..61319465,61319588..61320166)


exon

Literature and cross-references SbPrx104 (Sobic.007G192300.1 [2.1] / Sb07g026130 [1.4])
Literature Cordonnier-Pratt,M.-M. et al., unpublished
DNA ref. Phytozome 11:   chromosome_7 (61317427..61320166)
Cluster/Prediction ref. UniGene:   Sbi.19644 [3' end]
Protein sequence: SbPrx104 (Sobic.007G192300.1 [2.1] / Sb07g026130 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (312)
PWM (Da):   %s   36317.56 (33836.2) Transmb domain:   %s   i7-26o
PI (pH):   %s   8.19 (7.31) Peptide Signal:   %s   cut: 25 range:25-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKRRRGGVSSLMVLAAALLTVAAMPPPPRVAAALSPDYYKDSCPDLESIVRYEVTRKKNETVVTIPATLRLAFHDCMVGGCNAAVLIASKKNDAEKDAPDNESLAGDGFDTINRVKAAVEKKCPGVVSCADIIALATRDVVYLADGPYWRVELGRLDALASRASDVKGKLPDPDMHVKELMPVFQRNGFTKVDLVALSGAHTVGFAHCSRFTNRLYSYGGTSSRTDPTFNPDYAGQLKGACPVNVGPTIAVNMDPVSPIKFDNIYFINLQYGLGLFTSDQVLYTDETTRPIVDKFAASQKEFFDAFVAAMIKLGRLGVKTGKDGEIRRVCTAFNH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, introns 1 and 2) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGCGACGACGAGGCGGCGTGTCGTCCCTGATGGTGCTGGCGGCGGCGTTGTTGACGGTGGCCGCAATGCCGCCGCCGCCCCGCGTGGCGGCCGCGCTGTCGCCGGACTACTAC
AAGGACAGCTGCCCGGACCTGGAGTCGATCGTGCGGTACGAGGTGACGAGGAAGAAGAACGAGACGGTGGTCACCATCCCGGCGACGCTCCGCCTCGCCTTCCACGACTGCATGGTCGGG
GTGAGTAGTAGTAGCACACGTCGCACGCTTTGCCCTCCCCAAATCCCCCTCGCCTCCTCTGCTTTCACACACTAGTCCGTCCATGGTTCATTGATTCGTTCACGCGTGCGTGCTCCCCAT
CCTTTGCTTGCTCCGAGATGCAGAATTTAGCGCCTCTACTAGGGGACTGCAGCACTGGGTGCTGGAATTACTGATCTACTGCATTTTGATTTTAATCTGTTTTTTTTTGGTGGTGGTGGT
CTGGTTCTCAGTTGAGCTGTGAATTGTGATTCGTGCAGCAGAGTTTAGTTCCCAATCCCTCACTCTCACCCTCCTCTCTCTCAACTTGCTCTCCCCCTGTGTTGTGGAGGAATCAGAATC
ATTTTCTTTCTCATCTCCTTTGCTGTGTTCGGTCCAAGAAGGTAGAAGCCGTCTTTGGAACCACAAAGTTGCAAGTTGCGTACTGCTTTTCCAGTCAGATAACATGGGCTGTCTGCCGTC
CGTCTGCCTCTCTAGTCTCTGCTCACCATCACCACTGTACTGTGCATCATCGTGCTCCCCAGTTCGTCCTTCAATTGGCTCATCGCAAGATCGTGGTGAAAAAGAACAAAGGAGGGTGCC
TTGAGATGTTGCCAATAGAAAACCGGATTCGTTTTGGCCACCAAAAGCTACTGTACTGTACGGGCCACTAGCAGCGGGCAGCTGGATGCTGGGTGGAATGGATTGTTTAGCTGGCCGGGG
GAAGGGAAGGGAAGGGAGGGGGAACAACTCGAGAGCCCCGCGTGGTCGTCGGTTGCGGCAGAGAGGCGCGCATGTGACGACGCGGCTTTTCATCAGCCCCTCCGGATTATCAAAATGCCA
GCCGTGTCGGAGGCAGCGGGCAGCGGCGTGGCGTCTGGTCAGAAACCGGCACCCCGAATCCCGAGCGCGTCGTCGACCTGCCGGAAATGAGGACGGCCAACTCATCATCTGTTTCTGGGT
TCTGTCTGAAAATCCTCGCGAAAACTTTTTATGGAAGAGAATTCTTCAGGTTCATTCAGGCATAGCTGGCTGCTTTGGAAACGATTTTAATCATGTTTCACACTTTCACCAACTCTTCAC
TTGCAGCCGGTTTGGTTTCGGTTTTTTTGGAAGGATATACTCAGACTAATCATACCTGCTGGATGCTGAAGCTCAACAGCTGGTTGCCTGGTTCCATTGCATGTTGCCAAGAATATGATG
AAGATGCTAGTGGTGTTGTTTAGTGGCATCCTGGCAAGCAAGTAGCTGGCATCTTATTCCAGTCTTTTTTCTCTCAACCTTTTCTTCTCTGGGTTGACCGAATACATCGGGTGCCGCGTG
AGTTCACGTCGAGCACCAGTTGTATTTGTATAGGACCCACGTCTACGGATAGCCAGGCGTATTTCAGATTCAATCTTTTATAAACCTTTCTTATTTCAGGCTCAATCTTTTATAAACCTT
TCTTTATGAGAAAAATAAAAAAAACATTTTCCGGCCACCAACGTTTCAGAACACAATTTCAACTGCCAAATTATAAGCTCTATATAATTTTCGTTTATCATCGCAGTTACATTACATTTC
TAGTAGTAATTCTGAAGTAACCCTGCCGTTCCTCACCTCAATCACAGGGTTGCAACGCCGCCGTCCTGATTGCGTCCAAGAAGAACGACGCCGAGAAGGACGCGCCAGACAACGAGTCAC
TCGCCGGCGACGGCTTCGACACCATCAACCGGGTCAAGGCCGCCGTCGAGAAGAAGTGCCCCGGTGTGGTCTCCTGCGCCGACATCATCGCACTCGCCACCAGAGACGTCGTGTACCTG
G
TAATTAACCACCGCCTTCATCTCCCCGCCGGCGATCAGCTTCCGAGCTCCGATGGAGCCAGTCCTGGCCCTCCATCAACTACTTGATGACATATTGGTGGTGGCAATGCAATGGCATGCA
GGCGGATGGCCCCTACTGGCGCGTGGAGCTCGGCCGGCTCGACGCCCTCGCCTCCAGGGCCAGCGACGTCAAGGGGAAGCTGCCGGACCCGGACATGCACGTCAAGGAGCTCATGCCGGT
GTTCCAGAGGAACGGCTTCACCAAGGTGGACTTGGTCGCCCTCTCCGGCGCGCACACCGTCGGCTTCGCGCACTGCTCCCGCTTCACCAACAGGCTCTACAGCTACGGCGGCACCAGCTC
GCGGACGGACCCGACGTTCAACCCCGACTACGCCGGTCAGCTCAAGGGGGCGTGCCCTGTCAATGTCGGCCCGACCATCGCCGTCAACATGGACCCTGTCAGCCCCATCAAATTCGACAA
CATCTACTTCATCAACTTGCAGTACGGGCTGGGGCTCTTCACCTCCGACCAGGTGCTCTACACCGACGAGACGACGAGACCCATCGTCGACAAGTTCGCCGCCAGCCAGAAGGAGTTCTT
TGATGCTTTCGTCGCCGCCATGATCAAGCTGGGGAGGTTAGGGGTGAAGACAGGGAAGGATGGAGAGATCAGAAGAGTCTGCACTGCCTTCAACCATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAGCGACGACGAGGCGGCGTGTCGTCCCTGATGGTGCTGGCGGCGGCGTTGTTGACGGTGGCCGCAATGCCGCCGCCGCCCCGCGTGGCGGCCGCGCTGTCGCCGGACTACTAC
AAGGACAGCTGCCCGGACCTGGAGTCGATCGTGCGGTACGAGGTGACGAGGAAGAAGAACGAGACGGTGGTCACCATCCCGGCGACGCTCCGCCTCGCCTTCCACGACTGCATGGTCGGG
GGTTGCAACGCCGCCGTCCTGATTGCGTCCAAGAAGAACGACGCCGAGAAGGACGCGCCAGACAACGAGTCACTCGCCGGCGACGGCTTCGACACCATCAACCGGGTCAAGGCCGCCGTC
GAGAAGAAGTGCCCCGGTGTGGTCTCCTGCGCCGACATCATCGCACTCGCCACCAGAGACGTCGTGTACCTG
GCGGATGGCCCCTACTGGCGCGTGGAGCTCGGCCGGCTCGACGCCCTC
GCCTCCAGGGCCAGCGACGTCAAGGGGAAGCTGCCGGACCCGGACATGCACGTCAAGGAGCTCATGCCGGTGTTCCAGAGGAACGGCTTCACCAAGGTGGACTTGGTCGCCCTCTCCGGC
GCGCACACCGTCGGCTTCGCGCACTGCTCCCGCTTCACCAACAGGCTCTACAGCTACGGCGGCACCAGCTCGCGGACGGACCCGACGTTCAACCCCGACTACGCCGGTCAGCTCAAGGGG
GCGTGCCCTGTCAATGTCGGCCCGACCATCGCCGTCAACATGGACCCTGTCAGCCCCATCAAATTCGACAACATCTACTTCATCAACTTGCAGTACGGGCTGGGGCTCTTCACCTCCGAC
CAGGTGCTCTACACCGACGAGACGACGAGACCCATCGTCGACAAGTTCGCCGCCAGCCAGAAGGAGTTCTTTGATGCTTTCGTCGCCGCCATGATCAAGCTGGGGAGGTTAGGGGTGAAG
ACAGGGAAGGATGGAGAGATCAGAAGAGTCTGCACTGCCTTCAACCATTAG

Retrieve as FASTA