Entry information : AdelCIIBA11 (GP11)
Entry ID 9705
Creation 2011-11-16 (Christophe Dunand)
Last sequence changes 2011-11-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-02-02 (Christophe Dunand)
Peroxidase information: AdelCIIBA11 (GP11)
Name (synonym) AdelCIIBA11 (GP11)
Class Other class II peroxidase type A    [Orthogroup: CIIBA002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Auriculariaceae Auricularia
Organism Auricularia delicata    [TaxId: 160860 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AdelCIIBA11
start..stop
S start..stop
AdelCIIBA03 570 0 26..364 25..362
AdelCIIBA02 569 0 23..364 23..363
AdelCIIBA14 568 0 2..364 4..365
AdelCIIBA10 567 0 23..364 23..363
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8315..8363 49 N° 2 8202..8257 56 N° 3 8138..8155 18 N° 4 8065..8090 26
N° 5 7872..8017 146 N° 6 7779..7821 43 N° 7 7580..7721 142 N° 8 7514..7533 20
N° 9 7445..7452 8 N° 10 7321..7390 70 N° 11 7122..7264 143 N° 12 6967..7065 99
N° 13 6812..6912 101 N° 14 6687..6761 75 N° 15 6570..6637 68 N° 16 6491..6521 31
complement(join(6491..6521,6570..6637,6687..6761,6812..6912,6967..7065,7122..726 4,7321..7390,7445..7452,7514..7533,7580..7721,7779..7821,7872..8017,8065..8090,8 138..8155,8202..8257,8315..8363))


exon

Literature and cross-references AdelCIIBA11 (GP11)
DNA ref. JGI genome:   scaffold_105 (8363..6491)
Protein sequence: AdelCIIBA11 (GP11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364 (347)
PWM (Da):   %s   38206.67 (36666.8)  
PI (pH):   %s   3.95 (3.95) Peptide Signal:   %s   cut: 18 range:18-364
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLAAALATLALAGVTTARPAASVCADGVTTVNNPCCFWANVRDRFINEIFLGVCQENVHSLVRIAFHDAIGFSLTDPSKGGGADGSIIMFGDTELNHANEGIDFITAFLQPFADTVGVTYGDAIQFGAAVGLSLCPGAPTIPAFVGRPNATMAAPDLVPEPFDDPKIFARMADAGFTPVELIHLLASHSIADQAGVDPEPQVLGAPFDSTPFSFDSQVFLEVLFEGILFPGSGPNGELMSPLPGEFRLQSDKRFSLHNETACAWQENALSQSAMASNFQTAFTKLSLLGHDQNSLLDCSELAQAPPATASQGFFPAGKTMEDLEIGCDAEAFPTTLVTQAGQPTMIPPVDVQDIAFGN

Retrieve as FASTA  
Remarks Complete sequence from genomic (15 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCTGCTGCTCTTGCCACTCTCGCCCTCGCCGGGGTAACAACGGGTACGCATCACTGCAGTAATGAGGTTCCCTGGTTGCCCGCTGACGGGAATTCCCCAGCTCGTCCTGCTGCG
TCGGTATGCGCAGACGGCGTTACCACCGTCAATAACCCGCAG
GTGAGTCCTCTCAGGCTGAAAGTGGTGGCGCCAATAATTGTCATAGTGCTGCTTCTGGGCAAACGTGAGTCCTTGTCT
TGCGTAAGGATATGACACCTTAACCTTGCCCAGGTTCGCGACAGGTTTATCAACGAGATGTATGTCTTCCAATTCTCGTGGGCTACAAAGGGCTGACACGCAGTAGTTTCCTCGGCGTCT
GTCAAGAGAACGTGCACTCTCTCGTCCGAATCGCCTTCCACGACGCAATTGGGTTCTCATTGACGGACCCTAGCAAAGGCGGAGGCGCGGACGGGAGTATAATCATGTTCGGAGACACGG
AACTCAACTTCC
GTAAGCATTATCTTTTTAGGACACGGGGAAACACACTCAGTCAGCTCCAGATGCCAACGAGGGAATCGACTTCATCACCGCTTTTCTCCAGCCGTACGTGCCACGCGC
CAACTCGCGAGGCAAACTGCATGCTGATCCGTGGGGCCGCAGATTCGCCGACACGGTCGGTGTCACCTATGGCGATGCTATCCAATTTGGCGCTGCTGTCGGGCTCTCGCTCTGCCCTGG
GGCGCCGACCATTCCCGCCTTCGTCGGCCGCCCGAATGCGACTATGGCTGCGCCAGACCTCACC
GTGAGTCAGCAGCGAGATACCCATTCGTGAGCTCATCTTGTCCGAGGTTCCCGAAC
CGTTCGACGA
GTGCGTCTCGTCCAAGGGTTTTCCCTGATGGCTCTTACTCACCTGCCTGTGCGTCTCACAGCCCGGACAGTACGTACTTTCTTAGTAGTGCGTGTCTGATCACTGCTCAC
AACCGCTCCCCAGAGATCTTCGCGCGCATGGCAGACGCAGGCTTCACACCCGTGGAACTCATTCACCTCCTCGCATCGCACAGGTACGTGCTTCTGCCAGTCCCCTCGTCGTTTGTAGGT
GTGAAACATCGCATCCTAGTATCGCCGATCAGGCCGGTGTGGACCCGGAACCGCAGGTCCTCGGCGCACCGTTCGACTCGACGCCATTCAGCTTCGACTCGCAGGTCTTCCTCGAAGTTC
TTTTTGAGGGCATCCTCTTCCCAGGCTCGGGCCCTAACCCTG
GTACCGTCTCTTCCCGCCGTGAACGTCTCATGGCGCGTCCCGCTGACAGGACGCAGGCGAGCTCATGAGCCCTCTTCC
GGGCGAATTCCGCCTGCAGTCCGACAAACGCTTCTCGCTGCACAACGAGACAGCGTGCGCCTGGCAGGAGAACGCCC
GTACGCCTATCATCCCCAGCAGTCTCGCGCGACGAATCTAACG
TAGCGGCATAGTGAGCCAATCTGCGATGGCGTCGAACTTCCAGACGGCATTCACCAAGCTGTCTCTCCTCGGCCATGACCAGAATTCTCTCCTCGACTGCAGCGAGCTCATCGTAAGCTG
AGGCCGCGAGACGTTGGTGTACTGCTGATCGGATCGCGACAGGCCCAGGCGCCCCCTGCGACGGCCAGCCAGGGATTCTTCCCCGCGGGAAAGACGATGGAAGATCTTGAGATCGGGGTG
CGTCGTTGGGCATGCTGTCGCCGGCGTTTCTCACTGTCCATGGAAGTGCGACGCGGAAGCGTTCCCAACAACTCTCGTGACCCAGGCGGGCCAGCCGACGATGATCCCCCCTGTGTGAGT
CCGCCTGCTGTTTGTTTTCTCACTCTGATGCGGGCACGGTAGGGATGTCCAGGACATCGCATTTGGAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCGCTGCTGCTCTTGCCACTCTCGCCCTCGCCGGGGTAACAACGGCTCGTCCTGCTGCGTCGGTATGCGCAGACGGCGTTACCACCGTCAATAACCCGCAGTGCTGCTTCTGGGCA
AAC
GTTCGCGACAGGTTTATCAACGAGATTTTCCTCGGCGTCTGTCAAGAGAACGTGCACTCTCTCGTCCGAATCGCCTTCCACGACGCAATTGGGTTCTCATTGACGGACCCTAGCAAA
GGCGGAGGCGCGGACGGGAGTATAATCATGTTCGGAGACACGGAACTCAACTTCC
ATGCCAACGAGGGAATCGACTTCATCACCGCTTTTCTCCAGCCATTCGCCGACACGGTCGGTGTC
ACCTATGGCGATGCTATCCAATTTGGCGCTGCTGTCGGGCTCTCGCTCTGCCCTGGGGCGCCGACCATTCCCGCCTTCGTCGGCCGCCCGAATGCGACTATGGCTGCGCCAGACCTCACC
GTTCCCGAACCGTTCGACGACCCGGACAAGATCTTCGCGCGCATGGCAGACGCAGGCTTCACACCCGTGGAACTCATTCACCTCCTCGCATCGCACAGTATCGCCGATCAGGCCGGTGTG
GACCCGGAACCGCAGGTCCTCGGCGCACCGTTCGACTCGACGCCATTCAGCTTCGACTCGCAGGTCTTCCTCGAAGTTCTTTTTGAGGGCATCCTCTTCCCAGGCTCGGGCCCTAACCCT
G
GCGAGCTCATGAGCCCTCTTCCGGGCGAATTCCGCCTGCAGTCCGACAAACGCTTCTCGCTGCACAACGAGACAGCGTGCGCCTGGCAGGAGAACGCCCTGAGCCAATCTGCGATGGCG
TCGAACTTCCAGACGGCATTCACCAAGCTGTCTCTCCTCGGCCATGACCAGAATTCTCTCCTCGACTGCAGCGAGCTCATC
GCCCAGGCGCCCCCTGCGACGGCCAGCCAGGGATTCTTC
CCCGCGGGAAAGACGATGGAAGATCTTGAGATCGGG
TGCGACGCGGAAGCGTTCCCAACAACTCTCGTGACCCAGGCGGGCCAGCCGACGATGATCCCCCCTGTGGATGTCCAGGACATC
GCATTTGGAAATTAA

Retrieve as FASTA